KEGG   Pyrolobus fumarii: Pyrfu_0052Help
Entry
Pyrfu_0052        CDS       T01620                                 

Definition
(GenBank) adenylyl cyclase CyaB
  KO
K05873  adenylate cyclase, class 2 [EC:4.6.1.1]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pyrfu_0052
Enzymes [BR:pfm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Pyrfu_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-ProteinID: AEM37924
UniProt: G0EE08
Position
complement(43130..43666)
Genome map
AA seq 178 aa AA seqDB search
MREVEAKLVLGDCIMLAAIEERVKRMGGVYEGEYIEEDVYFQHPCRDFAKTDEALRVRVV
KERVELTYKGPKEGGVYKARREITVQVDSASNVRALLEALGFKPVAVIRKKRRYYRLGRV
KVTLDEVEGLGCFAEIEAIDGGEEAVGEAIRLLGLEEVPTTTKSYLELLLEREGLSRR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggaggttgaggcgaagctcgtgcttggcgattgtatcatgctggctgctatagag
gagcgtgtcaagaggatgggtggcgtctatgagggtgagtatatcgaggaggatgtgtac
ttccagcatccatgtagggactttgcaaagacggatgaagccctacgcgtaagggtggtg
aaggaacgagtagaactcacgtacaagggtcccaaggagggtggcgtctacaaggctagg
cgcgagattacagtgcaggtagacagcgctagcaatgttcgtgcgttgcttgaagctctt
ggtttcaagcctgttgcggttatacggaagaagaggcgctactatcgcttaggccgtgtt
aaggtgacgcttgatgaggtagagggtctgggctgcttcgctgagatagaggctattgat
ggtggagaagaggctgttggtgaagccatacgcctccttggcctggaggaagtgccgacg
actacgaagtcctacctggagcttctgctcgagcgggaaggattaagccggcggtag

DBGET integrated database retrieval system