KEGG   Pyrolobus fumarii: Pyrfu_0055Help
Entry
Pyrfu_0055        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM37927
UniProt: G0EE11
Position
46291..47088
Genome map
AA seq 265 aa AA seqDB search
MLIRVGLGVWNGTERAVSQGLVWVEPGRVLGAEGLGVVVKRGVGADIDEGVLVVLSRVPK
EGLPGVAINGWLASYTSLPFSSLAQLDKGVCKREPRACALAFSAGLGIAAVISSHGELGV
LGCGFSSLSAALASMEYGATTRLYCLDSIGARIASRLGLEVLSAKRREPKEETLYLASID
PRLVRLVENRRGSRLLLHPIFLHYPPPRTIDTYTSVLRESRVHEGVKLLLKHIDFLDAAV
GHADLEALPYSHGKLAIIARLHNVV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatacgcgttggactaggggtgtggaatggcacggagcgcgcggtatcacagggg
ctggtttgggttgaacccggtagggttcttggcgcagaaggtctcggtgttgttgttaag
cgcggcgtaggggccgatattgacgagggtgttcttgtcgtactttcgagggtgcctaag
gagggtttacctggagtggctattaacggctggcttgcgagttacacgtcgcttcccttc
tcgtcgctcgcccagcttgataagggtgtttgtaaacgcgagcctagagcttgcgctctt
gcctttagcgctggactaggcatagccgcagttatatcgtcacacggcgagctaggggtg
ctcggctgtgggttctcctcgttatcagctgcactagcctctatggagtatggcgcgaca
acgcgactatactgcttggattctatcggcgcaaggatagcctctaggcttggcctagag
gtgctctcagcgaagaggagagagccgaaagaagagacgctctacctggcatctatagat
ccgcggcttgtaaggctagtcgaaaataggagaggctcgcgcctattgctacacccgatc
tttctccactacccgccaccacgcacaatagacacatacacatccgtactgagagagtcc
cgtgttcacgagggagtgaagctgcttctcaaacacatagattttctagatgctgccgtg
gggcatgcagatctagaagcactgccatattcacacggtaaactcgccattatcgctcgg
ctacacaacgtagtctga

DBGET integrated database retrieval system