KEGG   Pyrolobus fumarii: Pyrfu_0058Help
Entry
Pyrfu_0058        CDS       T01620                                 

Definition
(GenBank) H+transporting two-sector ATPase E subunit
  KO
K02121  V/A-type H+/Na+-transporting ATPase subunit E
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00190  Oxidative phosphorylation
pfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pyrfu_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: vATP-synt_E Cache_3-Cache_2 DUF445 AAA_13
Motif
Other DBs
NCBI-ProteinID: AEM37930
UniProt: G0EE14
Position
complement(48738..49364)
Genome map
AA seq 208 aa AA seqDB search
MGPVPRIHMHGDPHAVAKKASEKVREEINKKIDEALDAAIRILDAAKNRALAKLEKDISA
ILREAEEKVRAERAVREAELRVAELNARNEWIEKAVNEALRRLRSRVGDEAYTAFLEDML
KRAAETIRETATEAVVYPTKADRDLLEKLVGGASLPVKFTLAGEDIEGVGGFVVATPDGK
MRLDYRLEAVLSDILEEAKAAAAKALFG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtggggccggtgccccgcatacacatgcatggcgacccacacgcggtagcgaaaaaggcc
tctgaaaaggtgcgcgaggagataaacaagaagattgatgaggcgctcgacgctgctatc
cgcatcctcgacgcggcgaagaacagggctctagcgaagctcgagaaagacatctcggct
attctccgtgaggctgaggagaaagtaagagcggagagggcggtacgcgaggctgagttg
agagtggcggagctaaacgcgaggaacgagtggatagagaaggctgtcaacgaggcccta
agaaggctccgcagccgcgttggagacgaggcttacacagcgttcctcgaggacatgttg
aagcgtgctgccgagactatacgcgagacggctaccgaggccgtagtatacccgacgaag
gcggaccgcgacctacttgagaagctggttggtggtgcaagccttccggttaagttcacg
cttgcaggcgaggacatcgagggtgtaggaggcttcgtggttgcaactcccgacggcaag
atgcgcctcgactacaggctagaggcggtactctcagacatcctggaggaggcgaaggca
gcggctgctaaagcactattcggctaa

DBGET integrated database retrieval system