KEGG   Pyrolobus fumarii: Pyrfu_0059Help
Entry
Pyrfu_0059        CDS       T01620                                 

Definition
(GenBank) Vacuolar H+transporting two-sector ATPase F subunit
  KO
K02122  V/A-type H+/Na+-transporting ATPase subunit F
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00190  Oxidative phosphorylation
pfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pyrfu_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_F LUD_dom MAAL_C
Motif
Other DBs
NCBI-ProteinID: AEM37931
UniProt: G0EE15
Position
complement(49368..49679)
Genome map
AA seq 103 aa AA seqDB search
MPEKRIAVIADEYTATAFRLIGVEAYVAKDSGEARKILQKLLESTEVGVILVSNEYADAV
KDIVEKIGDERSDVVVAMLPTLKSPGKPVDMRRLLLQALGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgagaagaggatagccgtgatagccgacgagtataccgccacggccttccgcctt
ataggcgttgaggcctacgtcgctaaggatagtggcgaggcccgcaagatactacagaag
ctattggagtcgacagaggttggcgtgatactggtttccaacgagtatgcggatgctgtc
aaggacatcgttgagaaaatcggggatgagcgcagcgatgttgtcgtagcgatgctcccg
actctgaagagcccaggcaagccggtagacatgagaagacttcttctccaggcgctcggc
ttcggcgggtag

DBGET integrated database retrieval system