KEGG   Pyrolobus fumarii: Pyrfu_0086Help
Entry
Pyrfu_0086        CDS       T01620                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K01515  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pyrfu_0086
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     Pyrfu_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX T2SSE DUF3218
Motif
Other DBs
NCBI-ProteinID: AEM37958
UniProt: G0EE42
Position
75626..76159
Genome map
AA seq 177 aa AA seqDB search
MEVKVLGERTTCKGIRYSLKALTIEVDGRRFEREVLTHPGAVAILPFLDGDTVVLLRQWR
PGCQCWLIEVPAGTMEPGETPDETARRELEEETGYTAERLYKVGEIYPTPGTSTEAIHLY
IAEGLKEGKAHPEEDELIEVIRVPLRKAVEMVVNGEIRDAKTVALLLLAWTGKHAVG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggaggttaaggttctgggcgagcgaaccacctgcaaaggtatcaggtactccctgaag
gcgttgactatagaggtggatggtaggcgcttcgagcgcgaggtgctaacacacccgggc
gcagtcgcaatactaccgttcctcgacggggacactgtcgtgctcctgcgccagtggaga
cccggctgccagtgctggctcatcgaggtgccagccggcaccatggagccgggcgagacg
cccgacgagacagccaggagggagctagaggaggagacgggatacacggcagagaggttg
tacaaggtcggcgaaatctacccaacgccgggcacaagcactgaggccatacacttgtac
atcgcggaggggttgaaggagggcaaggcacaccccgaggaggacgagctgatagaggtg
atacgcgtccctcttaggaaagccgtagagatggtagttaacggagagataagagacgca
aaaacggtcgcgctcctcctgctcgcctggacggggaaacacgcggtaggctaa

DBGET integrated database retrieval system