KEGG   Pyrolobus fumarii: Pyrfu_0088Help
Entry
Pyrfu_0088        CDS       T01620                                 

Definition
(GenBank) DNA-binding TFAR19-related protein
  KO
K06875  programmed cell death protein 5
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Pyrfu_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dsDNA_bind Radial_spoke_3 DUF4404
Motif
Other DBs
NCBI-ProteinID: AEM37960
UniProt: G0EE44
Position
complement(76927..77274)
Genome map
AA seq 115 aa AA seqDB search
MTAEYFDSELEELLRRKQQELARRLEEQKRREAELQAEAQRQALLRRILTSRARERLANV
RLVRPELAKVVEDQIIALVQMGRLQPPVDEDVVKELLEAVYEQTRYEPRIRIKRK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccgaatattttgactctgagctcgaggagcttctcaggcgtaaacagcaggag
ttggctaggaggctcgaggagcagaagaggcgtgaggctgagctccaagccgaggctcag
aggcaggccctgctgcgccgcatcctgacaagccgtgcgcgcgagaggctcgctaacgtg
aggctggttaggccggagctagccaaggtggtcgaggatcagattatcgctctcgtgcag
atggggcgtctgcagcccccggtagacgaggatgttgtgaaggagcttctagaggctgtg
tacgagcagacgagatacgagccacgtatacgaatcaagaggaagtag

DBGET integrated database retrieval system