KEGG   Pyrolobus fumarii: Pyrfu_0096Help
Entry
Pyrfu_0096        CDS       T01620                                 

Definition
(GenBank) PUA domain containing protein
  KO
K07398  conserved protein with predicted RNA binding PUA domain
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Pyrfu_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT_C2 PUA
Motif
Other DBs
NCBI-ProteinID: AEM37968
UniProt: G0EE52
Position
89862..90332
Genome map
AA seq 156 aa AA seqDB search
MKLRRASRWEIVRLRAIADYQFGLGAGECLVPDDAIVGVSPNTLRIREVYGGEGVLLATL
RASDYFFSLSIEGAKRLLSCFPRPRLRVVVDPSRVPHKSVPTEAILDVDEELRAGDEVIV
VDLGDSLVGVGRLRLSPLEIKSGVRGEAVRLRKKVR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttaggagggcgtcgcgctgggagattgtcaggctgcgggctattgcggattac
cagtttggtcttggtgctggtgagtgcctggttccggacgatgctattgtcggtgtgtcg
cctaacacgctgcgtatacgcgaggtgtatgggggtgagggtgtacttcttgctacgctg
cgtgcgagtgactacttcttctctttgagtatcgagggtgcaaagcggctgttgtcgtgc
ttccctaggcctaggctacgtgtcgtggttgacccttctcgcgtgcctcacaagtccgtt
cccacggaggccattctggatgttgacgaggagcttagggctggtgacgaggttatcgtt
gttgatttgggtgactctcttgttggtgttggtaggttgaggctctcgcctttagagata
aagtctggggtgaggggggaggctgttaggcttcggaagaaggtgcggtag

DBGET integrated database retrieval system