KEGG   Pyrolobus fumarii: Pyrfu_0120Help
Entry
Pyrfu_0120        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Muraidase
Motif
Other DBs
NCBI-ProteinID: AEM37992
UniProt: G0EEF1
Position
complement(110829..111110)
Genome map
AA seq 93 aa AA seqDB search
MRAFDVVRQVLTHALYNNGLVLDPYTTMEVATLIHLYITTGSRSHYEGAVRLLGFVLGKM
GYDDAERIASNIVEEVVNRVDLAAVRRTTDTEA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ttgagagcattcgacgttgtgcgtcaagtgttgacgcatgccctctacaataatgggctg
gtgctagacccttacacgacaatggaagttgcgacactaatccacttgtacataactacg
ggtagtaggagtcactacgagggcgcggtacgtctactgggttttgtgctgggaaagatg
gggtatgatgacgctgagcgcatcgcgagtaatatagttgaggaggttgtgaatagagta
gatttggcggctgtgaggagaaccaccgacaccgaagcctag

DBGET integrated database retrieval system