KEGG   Pyrolobus fumarii: Pyrfu_0129Help
Entry
Pyrfu_0129        CDS       T01620                                 

Definition
(GenBank) 2'-5' RNA ligase
  KO
K01975  RNA 2',3'-cyclic 3'-phosphodiesterase [EC:3.1.4.58]
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfm03016]
    Pyrfu_0129
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.58  RNA 2',3'-cyclic 3'-phosphodiesterase
     Pyrfu_0129
Transfer RNA biogenesis [BR:pfm03016]
 Prokaryotic Type
  tRNA spricing factors
   Other tRNA splicing factors
    Pyrfu_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigT_PEase 2_5_RNA_ligase2 AKAP7_NLS HVSL
Motif
Other DBs
NCBI-ProteinID: AEM38001
UniProt: G0EEG0
Position
complement(116696..117283)
Genome map
AA seq 195 aa AA seqDB search
MASRWDKIRAFIAVDIDDPQVVSRLVQIRDLFVNTGTPMKPVEDYNMHITLRFLGEIPST
LIEDIYANVLSKLRFRRFRIRLVGVGAFPSITRPRVIWVGVREGSDELQRLYREIESGLR
RMGFRPEREEFVPHVTLARIKGSRNIERVVKLLQEYADVELGEFEVRVVRLKQSILTPRG
PIYKTLKEVTAVEGE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgatgggacaagatacgtgctttcattgcagtcgatattgatgatcctcag
gtggtctctaggctcgtacagatacgtgatctcttcgtgaatactggcacgccgatgaaa
cccgtagaggattacaatatgcatataactttaaggttccttggtgaaatcccgtcaacg
ttaatcgaggacatctatgcgaatgtgttgtcaaagttgcgttttcgtagattccggatt
aggctggtgggagttggtgcatttcccagcataacgagaccgcgtgttatctgggtaggt
gtgagggaaggtagtgatgaattgcaaaggttgtatcgtgaaatagagagtggtcttagg
agaatggggtttaggccggaaagggaagagtttgttcctcacgtgacgcttgcaaggata
aaaggtagtaggaatatagaacgcgtggtgaaattgctacaagaatatgctgatgtagag
cttggcgagtttgaggttagggttgtgaggttgaagcagagtattctaacacctcgggga
ccaatatacaaaacgttgaaagaggttacagctgtggagggcgaatag

DBGET integrated database retrieval system