KEGG   Pyrolobus fumarii: Pyrfu_0136Help
Entry
Pyrfu_0136        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEM38008
UniProt: G0EEG7
Position
complement(120700..121446)
Genome map
AA seq 248 aa AA seqDB search
MHRLRLILLASLVLALEGYASIIAYFCPSLFCFEGGFWLLWGLWLGLHAAIIARCRVIET
VPFPVVVLAVGYGVLTGLALVMLGVVHLALVAFAASILSFIAMNRFECGALGLSSILVFY
TGVVALLSGVEPLLAAVVPTSLLAGFLVATLYVETYLLSRLGGRHWLVTAALGFTLLAIA
GFVAAYTMQPYRLLFSHEYSSQCSWSKYCVYIDTSTELPLASWGYTLLNLMQLALTGSIL
ALPTPRRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgactgaggttgatactgctagcctctcttgtactcgcactagagggttatgct
agtatcatagcgtatttctgtccatcgctattctgttttgaaggcggcttttggctgctg
tggggtctatggctagggttgcatgcagccatcatagctagatgtagagtgatagagact
gtgccattcccggtggttgtgctcgctgtcgggtacggcgtgctaacggggttggcactg
gtaatgcttggcgttgtacacttggcgcttgtagcgtttgcggcttcaatactttccttc
atcgcgatgaaccggtttgaatgcggagccctaggattatcctctattcttgtcttttac
actggggtggttgcgctactttctggcgtagagccgttactagcagctgttgtaccaacc
tcgctactagcgggcttcctagtggcaacgttatacgttgagacctaccttctctccagg
ctcggtggacgccattggctagtaacagctgctttaggttttacactactcgcaatagct
ggtttcgtggccgcgtataccatgcaaccctaccgtctactatttagccacgaatacagc
tcgcaatgctcatggagtaagtactgtgtgtacatagatactagcacggagctaccccta
gcatcgtggggttacacattgctaaatctaatgcagctggcgttaacgggctcaatactt
gctcttccaacacccaggcggcgttaa

DBGET integrated database retrieval system