KEGG   Pyrolobus fumarii: Pyrfu_0139Help
Entry
Pyrfu_0139        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF480 HTH_39 G-gamma
Motif
Other DBs
NCBI-ProteinID: AEM38011
UniProt: G0EEH0
Position
123893..124327
Genome map
AA seq 144 aa AA seqDB search
MNIEELKRMLERKIAFLEKKLEFYRMLLEALEACSEGGASLIEEIRDEEGRLVGRVYRSG
NTLKLILEKPVHISNPYVRHLARRIERLREEGIELELSLEKNEQGMVTSIVVRGPLESDE
ILETLQRLFRFVALRVSRGNTANA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaagagcttaagagaatgcttgaacgcaagatagcgttccttgagaagaag
ctcgaattctaccgcatgctgctagaggcgcttgaagcttgtagcgagggaggagcgtcg
cttatagaagagattcgtgacgaggagggtcgccttgtaggacgggtatataggtctggc
aatacactgaaacttatactagagaagccagtgcatatctccaatccttatgtgagacat
cttgcaaggcgcattgaaaggctcagagaagaaggtatcgaacttgagcttagcctcgag
aagaatgagcaaggtatggttacaagcatagttgttagaggccccttggaatcagatgag
atactagagactttacaacgcttgtttagatttgtcgctttgcgcgtctcgaggggcaac
accgctaacgcttaa

DBGET integrated database retrieval system