KEGG   Pyrolobus fumarii: Pyrfu_0143Help
Entry
Pyrfu_0143        CDS       T01620                                 

Definition
(GenBank) protein of unknown function DUF354
  KO
K09726  uncharacterized protein
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Pyrfu_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF354 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 Epimerase_2 Glyco_transf_28
Motif
Other DBs
NCBI-ProteinID: AEM38015
UniProt: G0EEH4
Position
complement(127946..128983)
Genome map
AA seq 345 aa AA seqDB search
MRIWIDALTPKQARLAAALYTRLVKEGYEVLVTARSYDFTESVLRRHGVNYVSVGRHGGE
SLKGKLEADIERMAALLRIIDEYKPDVLVSYPSPSATRVAFGLSIPIIVFSDSPHSVPPH
RLTIPLADVLIHSALVPRHHFEWYVLTRFTRVVSFYGIEEWEWIRGYRCNEGLLEDMGLE
PNKYIVLRVPERKAVYYQGRSIPNVNEIVDAIVKNGYQVVIFPRYEDDLQHLRHMVERYP
KMVKIVWGEAVETLDLYCHAAGVVTGGATMAREAALMCKPAISLYPTHINQVLEKMGFPI
RNIESVDKPDDIVTILEESRGLCPAEMLSRFEVPSDVLIRVLESI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgagaatctggattgacgcgttaactcctaagcaagctaggcttgctgctgccctctac
acgaggcttgtaaaggaagggtatgaggttctcgtaacagctcgtagctatgatttcacg
gagtctgtgctacgtagacacggcgtcaactatgtgagtgtagggcgtcatggcggagag
agtttgaagggcaagctagaagctgacattgagcgaatggcggctctgctgaggataatc
gacgagtataagcctgatgtgctagtgtcatatccgagtccatctgcgactagggttgct
tttggtctctcaatacccataatagtgttcagtgatagtcctcatagtgtccctcctcat
cggctaacaataccgttggctgacgtgcttatccactcggcgctggtgccccgccatcat
ttcgaatggtatgtgttgacgcgctttacgcgtgttgtaagcttctatggtatcgaagag
tgggagtggatacgcggctatcgttgtaacgaagggcttctggaagatatgggtctcgag
ccgaacaagtacattgttctgcgtgtacctgaaagaaaggctgtatattatcaaggtagg
agcatcccaaacgttaacgagatagtggatgctatcgtgaagaatggttatcaagttgtc
atattccctcgctacgaagatgatttgcaacatttgaggcatatggtagaacgataccct
aagatggtaaagatagtgtggggcgaggctgtagagactcttgatctatactgtcatgcg
gcgggagttgtgactggcggtgcaacgatggctcgcgaagctgcactcatgtgtaaaccc
gcgattagcctctatcccacgcatatcaaccaagttctcgagaagatggggtttccgata
cgcaacatagagtccgtcgataaacccgatgatatagtaacgattctagaagagagtaga
ggcttgtgcccagccgagatgctatccagattcgaggtgccaagcgacgttttgataaga
gtgttggaaagcatctag

DBGET integrated database retrieval system