KEGG   Pyrolobus fumarii: Pyrfu_0148Help
Entry
Pyrfu_0148        CDS       T01620                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 AraC_binding Cupin_7 Cupin_1 MannoseP_isomer GPI Cupin_3 PCO_ADO Auxin_BP ARD Ectoine_synth DMSP_lyase
Motif
Other DBs
NCBI-ProteinID: AEM38020
UniProt: G0EEH9
Position
complement(132661..133071)
Genome map
AA seq 136 aa AA seqDB search
MAVVRRGPCGEIVGNYTGVSEEKVVMNNVELKGVWIRWLIRGGEARGFAMRVFRIEPGAV
IPAHTHPWEHGIFVLKGEGVVRIGRSRYVVRAGDYLLIPPNVEHEYVNVGNEDFEFICVI
PSKATVDEKYDPCNKS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
ttggcagtagtacgtaggggaccgtgcggtgagatagtaggtaactatactggcgttagt
gaagagaaggttgttatgaataatgttgagttgaagggggtgtggatacggtggctcatt
cgtggtggagaagcgcgtggttttgcaatgagagtgtttagaattgagcctggtgcagtg
ataccagcgcatacgcatccttgggaacatggcatctttgtattgaagggagagggtgtt
gttcgtataggtcgtagtaggtatgttgtgcgtgcaggtgattacctattgataccgcct
aacgtggagcatgaatacgtaaacgtgggtaatgaggattttgagtttatctgcgtgatt
ccgtccaaggccactgttgacgagaagtacgacccttgtaacaagagttag

DBGET integrated database retrieval system