KEGG   Pyrolobus fumarii: Pyrfu_0149Help
Entry
Pyrfu_0149        CDS       T01620                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03885  NADH dehydrogenase [EC:1.6.99.3]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pyrfu_0149
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Pyrfu_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO Pyr_redox_3 UDPG_MGDP_dh_N K_oxygenase GIDA Lycopene_cycl AlaDh_PNT_C NAD_binding_8 ADH_N_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEM38021
UniProt: G0EEI0
Position
133444..134535
Genome map
AA seq 363 aa AA seqDB search
MKSVVVVGSGFAGVEAVSMLGRLCGEKLDCIWVSANGQLVFLPALPEVAGGRLNPEDVAW
SVERYAKRNGFQLVKQRVTVVEQSRIILENGEQISYDYLLLATGASPAFFNIPGAREHSI
PLYTVDAAVKIRDLIDRVNRIVIVGAGLVGVEVAAEAKIRRNDIHVTLVDMMDKPLAALR
NDKASRLVQQELEKLGIETLYGARVTAVKEGVIETTRGSIEADIVIWAAGLQACTPEIRV
DGIKRVKGGYLSVDPYLRVAGNIFAAGDVTCVECKGCYALKMVREAMRQGKTAARNIVTL
VTGSSKLARYKPLITDCRPLAGVTLGPKKGVLVYGKKFALKTGLVGWYKEWQRKRYASRL
TSA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgtggtcgtggttggctctggatttgcaggcgttgaggctgtcagcatgctc
gggcgtctatgcggcgagaagctcgactgcatatgggtgagcgccaatggccagcttgta
tttctgccagcattgccggaagtcgctggtggcagattaaaccccgaggatgtcgcgtgg
agcgtcgaaaggtatgccaagaggaatggtttccagcttgttaagcaacgcgtaaccgtt
gtagaacagtctcgcattatactcgagaatggtgagcagataagttatgattatctgctt
ctcgctactggcgcttcaccagcattctttaacataccgggtgcgcgcgaacacagcata
ccgttgtatactgttgacgcagctgtaaagatacgtgacttgatagacagggttaatcgt
attgttatcgttggtgcgggtcttgtgggtgtggaggtcgcagccgaagctaagatacgc
cgtaacgacatacacgtaaccctagttgatatgatggataagcctcttgccgccctccgt
aatgataaggcatcacgacttgtacagcaagagcttgagaagttgggtattgaaaccttg
tatggtgcacgcgtgacagcagtcaaagaaggtgtcatagaaactactcgtggcagcatt
gaagccgatatagtgatatgggcggctggattgcaagcatgcacgccagagatacgtgtt
gacggaatcaaacgcgtgaagggaggttatcttagcgttgatccttaccttcgcgtggct
ggcaacatattcgcagcaggtgatgtaacttgcgtagagtgcaaaggttgctatgcgctc
aagatggttagagaggctatgagacagggcaagacagcagcccgcaatattgtaactctt
gtaacaggttccagcaaactcgccaggtataagccgttgataacagactgtagaccgttg
gctggcgtcacactcgggcctaagaagggagtgctggtctacggcaagaagtttgcattg
aagactggcctcgtcggatggtataaagagtggcagaggaagcgttatgcatcaaggctc
acgagtgcatag

DBGET integrated database retrieval system