KEGG   Pyrolobus fumarii: Pyrfu_1216Help
Entry
Pyrfu_1216        CDS       T01620                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00020  Citrate cycle (TCA cycle)
pfm00640  Propanoate metabolism
pfm00660  C5-Branched dibasic acid metabolism
pfm00720  Carbon fixation pathways in prokaryotes
pfm01100  Metabolic pathways
pfm01110  Biosynthesis of secondary metabolites
pfm01120  Microbial metabolism in diverse environments
pfm01130  Biosynthesis of antibiotics
pfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pyrfu_1216
   00640 Propanoate metabolism
    Pyrfu_1216
   00660 C5-Branched dibasic acid metabolism
    Pyrfu_1216
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pyrfu_1216
Enzymes [BR:pfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pyrfu_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: AEM39078
UniProt: G0EFX7
Position
complement(1131670..1132815)
Genome map
AA seq 381 aa AA seqDB search
MNIVEFEAKRIAREYGIPIPEGRLATRPEEVIDAIHHLGLPVVIKAQVPVAGRGKAGGVK
LAKSEDEAYEIALKMLGSEIKGYPVYSVLVEEAVPHKQELYLSFIVNRSNRTITMLASSE
GGMEIEEIAAKKPWAIKRLDIDPFVGLKGYQVRKIAKNIGLSGQLLRQFEEIAKAMYKML
IEYDAELVESNPLAITEDGRIVALDFRMVVDDNAVYRHPEFEKLREYELRGLERIAHFYG
LAYVELDGDIGVIGNGAGLTMATLDMIYHYGGRPANFLDIGGGARRDKVKRAVTLLLRHP
KVKVILVNVFGGITRVDEVAHGIVAAYEESGVRKPLVARLVGTMEEEGRRILEEKGFKVY
QRMDEAVREAVRLAKEAGGEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatagtcgagttcgaggcgaagaggatagcgcgtgagtacggcataccgatacca
gagggtaggctggctacgcgccccgaggaggtaatcgacgctatacaccacctcggcctc
ccggtggttatcaaggcgcaggtgccggtggcaggcaggggtaaggccggtggcgtaaag
ctggcaaagagtgaggatgaggcctacgagatagcccttaagatgctcggctcggagatc
aaggggtacccggtctactctgtgctagtcgaggaggctgtgccgcacaagcaggagctc
tacctctccttcatagtcaacagaagcaacaggacgataacgatgctggctagcagcgag
ggtggcatggagatagaggagatagccgcgaagaaaccatgggcgatcaagaggctggat
atcgacccgttcgtcgggctcaagggctaccaggtcaggaagatcgccaagaacatcggg
ctatccgggcagcttctccgccagttcgaggagatagccaaagccatgtacaagatgctg
atcgagtatgacgcggagctcgtcgagtccaacccgttggccatcaccgaggacgggagg
attgtggcgctcgacttcaggatggtggtcgacgataacgcggtgtataggcacccggag
ttcgagaagctccgcgagtatgagctacgcggcctggagaggatagcccacttctacggc
ctcgcgtacgtcgagctggacggcgacatcggtgtaattggcaacggcgctggcctcacg
atggcaactctcgacatgatataccattacggcggtaggcccgcgaacttcctcgatatc
ggcggcggcgcgcgccgcgacaaggtcaagagggctgttacgctcctcctccgccaccca
aaggtcaaggtcatactagtgaacgtcttcggcggcattactcgcgtggacgaggtggcg
cacggtatcgtcgctgcttatgaggagtctggtgtgaggaagccgctggtggcgaggctc
gtgggcaccatggaggaggagggtaggcgtatcctcgaggagaagggattcaaggtgtac
cagaggatggatgaggccgtacgcgaggccgtgaggctcgcgaaggaggctgggggtgag
gcgtga

DBGET integrated database retrieval system