KEGG   Pyrolobus fumarii: Pyrfu_1306Help
Entry
Pyrfu_1306        CDS       T01620                                 

Definition
(GenBank) protein of unknown function DUF207
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfm03016]
    Pyrfu_1306
Enzymes [BR:pfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     Pyrfu_1306
Transfer RNA biogenesis [BR:pfm03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    Pyrfu_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: AEM39165
UniProt: G0EGE0
Position
1212177..1212854
Genome map
AA seq 225 aa AA seqDB search
METPDEKLWLDRKIRSWERLWEDLEIGYLDRDIIDILVEFFLRPKSFTTSSCSGRIVVMD
AEYPWDKEETMIIFKKHEPVTVDEIIEVVERPLAYRPWLSVQGPIIHVETLDIDEAFEVL
EIARRAGFKHSGILASTKKGILVELRTGIRVNIPLGSRDNLWVDKERLRDIISLANNALR
QAKDRLARLRDELRKARPASLWSPPSIPPAAQHYLKLLGVSPAVK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcccgatgagaagctatggttggataggaagattaggagctgggagaggctg
tgggaggatctcgagataggctatcttgatcgcgatataatcgacattcttgtcgagttc
tttctccgccctaagagctttacaacgagtagctgtagcggccgcatagtcgtcatggat
gccgagtacccgtgggataaggaggagacgatgataatattcaagaagcacgagccagtg
actgttgatgagataatcgaggtggtagagaggcctcttgcatatagaccttggctgagc
gtacaaggcccaatcatacacgtggagacactcgatatagatgaggcgttcgaagtgcta
gagatagctaggagagctggcttcaaacacagcggcatactcgcatcaacaaagaagggt
atactcgtggagctaagaaccggtatacgtgtaaacatccctctaggctcgcgggacaac
ctctgggttgataaggagagactgagagacatcataagcctcgctaataatgcactaaga
caagcgaaggacagacttgcaagactccgcgacgagctaaggaaggctaggccagccagc
ctatggagcccgcctagcataccccctgcagcccagcactatctcaaactgctcggcgtg
tcaccagccgttaaataa

DBGET integrated database retrieval system