KEGG   Pyrolobus fumarii: Pyrfu_1447Help
Entry
Pyrfu_1447        CDS       T01620                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00340  Histidine metabolism
pfm01100  Metabolic pathways
pfm01110  Biosynthesis of secondary metabolites
pfm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Pyrfu_1447
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pyrfu_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEM39305
UniProt: G0EH81
Position
complement(1357527..1358816)
Genome map
AA seq 429 aa AA seqDB search
MGELVVTSFDDPRLPELLRRPYNIEEYVEKVRPIVRDVAEKGLEALREYSRKFDKVEPKF
VVIDALEAWEIVKKVEARILDALKRAIDAVYAFHMRLYEELLSTPRSFARMGITFKPLIR
PLQSVGAYVPGGEHPYPSSAVMTVVPARVAGVERIVVATPPMREGDNAGLPNPLAVAAAV
LAGATEILVAGGAQAIAALAYGLKGVLEPVDKIVGPGSPYVEAAKLLVSHRVGIDMVAGP
SEVAVIADGKADARSIALEMLSQLEHGPFSTALLVTNSPWLVEAVQLLLEKHVKSENMGR
AIIVKVDTLEKGVKIVEKFAPEHLYIEADGAEKLAARIRNAGIVSIGIPTALTDYSAGPS
HVLPTGGYARVRGGLTPLDFVKVSVVVSGRLVHPQLVEAAIALAEAEGFKWHAESLRYWL
EKSRRGLTT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggagaactcgtagtcacgagttttgacgatccgcgtctgccagagttactgcgccga
ccgtacaacattgaagagtatgttgagaaggttcgcccgattgtgcgtgacgtggcggag
aagggtctagaagccctacgcgagtatagcaggaagtttgacaaggttgaacccaagttc
gtagtcatagatgcgctggaggcatgggagatagtcaagaaggtcgaagctaggattcta
gatgcgctcaagagggccattgacgctgtctatgcgttccacatgcggctgtatgaggag
ttgctaagcacgcctagaagctttgcccgaatgggcataacgttcaagcctctgatacgc
ccgcttcagagtgtaggcgcttatgtgcctggaggcgagcatccatacccatcctcggct
gtaatgacagtcgtgccggcgagggtggcaggcgtcgagcgtatagtggtcgccacgccg
cctatgagggagggggacaacgccggactgccgaaccccctcgctgtggctgcagcagtg
ctggcaggcgctactgagatccttgttgcaggcggggcacaggcgattgcagcgctagcc
tacggtttgaaaggtgtgctagaacctgtggacaagatagtcgggccgggcagcccatat
gttgaggctgctaagctacttgtgtctcaccgtgtaggtatagacatggtagcagggcct
agcgaggtagcggtgatagctgatggaaaggctgacgcgaggagcatcgcactagagatg
ttgtcgcagctggagcatggtcccttctcgacagcattgctagtcaccaactccccgtgg
cttgttgaagctgtccagctcctgctagagaagcacgtgaagagcgagaacatgggccgc
gcaatcatagtaaaagttgacacgttggagaaaggagttaagatagtcgaaaagtttgca
ccagaacacctctacatcgaggccgatggtgccgagaaactcgcagcaaggataagaaac
gctggcatcgttagcattggtatccctaccgcgttaaccgactactcggcgggaccaagc
cacgtgctacccactggcggctacgcgagagtacgtggagggttaacaccactcgacttc
gtcaaagttagtgtagtggtgtcgggccgcctagtgcacccccagctagtagaagcagca
atagcgcttgcagaagcagagggcttcaagtggcacgcagagtctctacgctactggtta
gaaaagagcagaagggggttaaccacctag

DBGET integrated database retrieval system