KEGG   Pyrolobus fumarii: Pyrfu_1972Help
Entry
Pyrfu_1972        CDS       T01620                                 

Definition
(GenBank) ribosomal protein S13P
  KO
K02952  small subunit ribosomal protein S13
Organism
pfm  Pyrolobus fumarii
Pathway
pfm03010  Ribosome
Module
pfm_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pyrfu_1972
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfm03011]
    Pyrfu_1972
Ribosome [BR:pfm03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Pyrfu_1972
  Archaea
    Pyrfu_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 MerR_1 FbpA
Motif
Other DBs
NCBI-ProteinID: AEM39825
UniProt: G0EDM1
Position
1832422..1832877
Genome map
AA seq 151 aa AA seqDB search
MSQQQQFRHIVRVAGTDLDGRLKVPFALAKIKGVGITFAYALCRLLGIDPEKRAGYLTDA
EIQKIEQALKDPKAIGIPSWMLNRRKDYETGRDMHLIGAELIYYARQDIERLKRIKSWRG
IRHALGLKVRGQRTRTTGRTGMTVGVSKRRK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcagcaacagcagtttaggcacatagtgcgtgtcgcgggtactgatctcgatggt
aggttgaaggttcccttcgccctggctaagataaagggtgtcggcataacgttcgcttat
gcactctgcagactccttggtatcgacccggagaagagggcgggctacctaactgacgcc
gagatacaaaagatcgagcaggcgctgaaggatccaaaggccattgggatcccgtcctgg
atgctcaacaggaggaaggactatgagactggccgcgacatgcacctcattggcgccgag
ttgatctactatgctaggcaggatattgagagattgaagaggatcaagtcgtggaggggt
atccgccacgcgctgggtctaaaggttaggggccagaggacgaggacaaccggccgtact
ggtatgactgtgggtgtctcgaagaggaggaagtag

DBGET integrated database retrieval system