KEGG   Pyrolobus fumarii: Pyrfu_1974Help
Entry
Pyrfu_1974        CDS       T01620                                 

Definition
(GenBank) ribosomal protein S11P
  KO
K02948  small subunit ribosomal protein S11
Organism
pfm  Pyrolobus fumarii
Pathway
pfm03010  Ribosome
Module
pfm_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pyrfu_1974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfm03011]
    Pyrfu_1974
Ribosome [BR:pfm03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Pyrfu_1974
  Bacteria
    Pyrfu_1974
  Archaea
    Pyrfu_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEM39827
UniProt: G0EDM3
Position
1833463..1833864
Genome map
AA seq 133 aa AA seqDB search
MAFTSREIKWGVAHIYSSYNNTIVHITDLTGAETVSRASGGMVVKADREKPSPYAAMLAA
SKAGQEAMEKGIMALHIKVRAPGGHGPKTPGPGAQAAIRALARMGFIIGRIEDVTPIPHD
TTRRPGGRRGRRV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacatccagggagataaagtggggtgtagcacacatctacagtagctacaac
aacaccatagtgcacataaccgacctcacgggagccgagacagtatctcgagctagcgga
ggcatggtcgtcaaggctgaccgcgagaagccaagcccctacgccgcaatgctagcagcc
agcaaggccggtcaagaagcgatggagaagggcataatggctctccacatcaaggtgcgc
gcccctggaggccacggaccaaagacgccaggcccaggcgcccaggcagccatcagggca
ctagcaaggatgggcttcatcataggcaggatcgaggacgtcaccccgataccacacgat
accaccaggcgcccaggaggccgccgcggacgccgtgtctaa

DBGET integrated database retrieval system