KEGG   Pseudomonas fluorescens UK4: HZ99_00995Help
Entry
HZ99_00995        CDS       T03319                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00071  Fatty acid degradation
pfn00072  Synthesis and degradation of ketone bodies
pfn00280  Valine, leucine and isoleucine degradation
pfn00310  Lysine degradation
pfn00362  Benzoate degradation
pfn00380  Tryptophan metabolism
pfn00620  Pyruvate metabolism
pfn00630  Glyoxylate and dicarboxylate metabolism
pfn00640  Propanoate metabolism
pfn00650  Butanoate metabolism
pfn00900  Terpenoid backbone biosynthesis
pfn01100  Metabolic pathways
pfn01110  Biosynthesis of secondary metabolites
pfn01120  Microbial metabolism in diverse environments
pfn01130  Biosynthesis of antibiotics
pfn01200  Carbon metabolism
pfn01212  Fatty acid metabolism
pfn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HZ99_00995
   00630 Glyoxylate and dicarboxylate metabolism
    HZ99_00995
   00640 Propanoate metabolism
    HZ99_00995
   00650 Butanoate metabolism
    HZ99_00995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HZ99_00995
   00072 Synthesis and degradation of ketone bodies
    HZ99_00995
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HZ99_00995
   00310 Lysine degradation
    HZ99_00995
   00380 Tryptophan metabolism
    HZ99_00995
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HZ99_00995
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HZ99_00995
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HZ99_00995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfn04147]
    HZ99_00995
Enzymes [BR:pfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HZ99_00995
Exosome [BR:pfn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HZ99_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIG00829
UniProt: A0A075P562
Position
274941..276239
Genome map
AA seq 432 aa AA seqDB search
MSDYSFSPAPTRRVAIVGGNRIPFARSNTVYAHDSNQDLLVAALQGLVDRYNLHGLRLGE
FAAGAVIKHSRDFNLARESLLSTTLSPETPAYDLQQACGTGLEAALLVANKIALGQIDAG
IAGGADTTSDAPIGINESLRRTLLAANRAKGRGNKLRSLLQVRPSMLFKPLLPRNGEPRT
GLSMGEHCEEMAKSWQIKRLAQDELTLSSHQRLDAAYKNGFFDDLISPYRGLARDNNLRA
DASLEKLASLSPAYDRHNGTLTAGNSTPLTDGASVVLLASEEWAAARGLPVLAYLRTGET
AAVNFVDGSEGLLMAPAYAVPRMLAREGLSFADFDFFEIHEAFAAQVLCTLKAWEDGDYC
RERLGLEAPLGPIERAKMNVNGGSLGCGHPFAATGGRQLAALAKAIHQRGGGRGLISICA
AGGLGITAIVEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactacagtttcagccccgccccgacgcgtcgcgtggcgattgtcggcggcaac
cgtattccgtttgcccgttccaatacggtgtacgcccacgacagcaaccaggatttgctg
gtggctgcgctgcaaggcctggtggaccgctacaacctgcacggcctgcgcctgggcgag
tttgccgccggcgcggtgatcaagcattcgcgggatttcaacctggcccgcgaatcgctg
ttgtccaccaccctgtctcccgagaccccggcctacgacctgcaacaagcctgtggcacg
ggccttgaggcggcgttgctggtggccaataaaattgcactcggccaaattgacgccggc
atcgccgggggggccgatacgacctccgatgcgcccatcggcatcaacgaatccctgcgc
cgcacgctgctggcggccaaccgcgccaagggccgcggcaacaaactgcgtagcctgttg
caggtgcgtccgtcgatgctgttcaagccgctgctgccacgcaatggcgagccgcgtacc
ggcttgtcgatgggcgagcactgcgaagaaatggccaagagttggcagatcaagcgcctg
gcccaggacgagttgaccctcagcagtcaccagcgtctcgacgcggcttataaaaacggt
tttttcgatgacctcatcagcccttatcgcggcctggcccgcgacaacaacctgcgcgcc
gacgccagcctggagaagctcgcgagcctgtccccggcctacgatcggcacaacggcacc
ctcacggcgggcaactccacgccattgaccgacggcgcctcggtggtgctgctggccagt
gaagaatgggccgctgcgcgcggcctgccggtattggcgtacctgcgcaccggcgagacc
gccgcggtgaacttcgtcgacggcagcgaaggcctgctgatggccccggcctatgccgtg
ccacgcatgctggcgcgcgaaggcctgagctttgccgatttcgatttcttcgagatccac
gaagccttcgcagcccaggtgctgtgcaccctcaaggcctgggaagacggcgattactgc
cgcgagcgcctggggctggaagcgccactggggccaatcgagcgcgccaaaatgaacgtc
aacggcggctcgctcggttgcggtcatccctttgccgccaccggcggccgccagttggcg
gcgctggccaaggccatccaccagcggggtggtgggcgtggcttgatttccatctgtgcc
gccggcggcctgggcattaccgccatcgttgagaagtag

DBGET integrated database retrieval system