KEGG   Pseudomonas fluorescens UK4: HZ99_10415Help
Entry
HZ99_10415        CDS       T03319                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pfn  Pseudomonas fluorescens UK4
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HZ99_10415
Enzymes [BR:pfn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     HZ99_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIG02542
UniProt: A0A379IHN9
Position
complement(2316349..2317212)
Genome map
AA seq 287 aa AA seqDB search
MNVDLHCHSTASDGALAPAVLVARAFEKGVRVLSLTDHDTLEGLDEARIAASALGMHLVN
GVELSCTWGGATIHVLGYGFDVTAPPLVAAIASLHDGRWLRSEEISRKLALKGMPNALEG
ARAIQQALGDSGNAPARPHFADWMVRQGYVKDRAEAFRKWLGAGKLGDVKLHWPTLEDTV
GTLRASGAWVSLAHPWHYDFTRSKRRKLIGDYIQAGGHAIEVVNGHQPAEQVGSLAILAR
EFGLLVSAGSDFHGPGGWSEIGEYRPVPEDLPLLSGRFKHDPITATV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttgatttgcactgccacagcacggcctccgacggcgccctggcgcccgcggta
ttggttgcgcgtgcgtttgaaaaaggcgtgcgagtcctgtcgttgactgaccacgacacc
cttgaaggcctggacgaggcgcgtattgccgcctctgcgctggggatgcacctggtcaat
ggcgtcgaattgtcctgcacctggggcggtgcaaccattcatgtactgggctacggtttc
gatgtcacagccccgccattggtcgcggccattgccagtttgcacgatggccgctggctg
cggtccgaagaaataagccgcaaactggccctcaaggggatgcccaatgcccttgagggt
gcccgtgccatccagcaggcgctgggcgacagcggcaacgcgccggcccgtccgcatttt
gccgactggatggtacgccagggttacgtcaaggatcgcgccgaagcgtttcgcaaatgg
ctgggcgccggcaagctgggggacgtcaagctgcactggccgaccctcgaagacactgtg
ggcaccctgcgcgcttcgggcgcctgggtcagtctggcgcatccctggcactatgatttc
acccgcagtaaacgccgcaagctgataggcgactatattcaagcgggtggccacgccatc
gaagtggtcaatgggcatcagcccgccgaacaggttggcagcctggcgattcttgcccgt
gaatttgggctgctggtcagtgccggcagtgatttccatggcccaggcggctggtcggag
atcggcgagtaccgcccggtcccggaagacttgccgcttttgtcggggcgattcaagcat
gaccccattaccgccactgtctga

DBGET integrated database retrieval system