KEGG   Pseudomonas fluorescens UK4: HZ99_12465Help
Entry
HZ99_12465        CDS       T03319                                 

Definition
(GenBank) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pfn  Pseudomonas fluorescens UK4
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HZ99_12465
Enzymes [BR:pfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     HZ99_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF442
Motif
Other DBs
NCBI-ProteinID: AIG02941
UniProt: A0A379IJ89
Position
complement(2761897..2762745)
Genome map
AA seq 282 aa AA seqDB search
MSFAVIQMVSQNDVLANLAQARRLLEQAAAGGAQLAVLPENFAAMGRRDVAAIGRAEALG
EGPILPWLKLAARDLKLWIVAGTLPLPPLDQPDAKSNACSLLIDAQGQVVARYDKLHLFD
VDVADARGRYRESDDYAYGNQVVVADTPVGRLGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYLLAAAQGGVHPGPRETYGHGAIVDPWGRVLAQQD
QGEAVLLAERDSSEQASIRARMPVAGHRRFFSQGAQRPASER
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgcggtaatccagatggtcagccagaacgatgttctggccaacctggcccag
gctcgacgcttgctggagcaggcggcagcagggggcgcacaactggcggtcctgccggaa
aattttgccgccatgggtcgccgtgatgtggcggctattggtcgtgcggaagcgctgggc
gaggggccgatcctgccctggttgaaactggccgcccgtgacctcaagttatggatagtg
gccggcacattgccattgcccccactggatcagcccgatgccaagtccaacgcctgctcg
ctgttgatcgatgcgcaggggcaggtcgtggcgcggtacgacaagctgcacttgtttgac
gtggatgtggctgacgcccgtggtcgttatcgtgaatctgacgactatgcttacggcaac
caggtggtggtggccgatacgccggtcgggcgcctggggctgacagtctgttatgacctg
cgcttcccggagctgtacagcgaattgcgtgcagcgggggccgaattgattaccgcgccc
tcggcctttacggcggtaaccggcgctgcgcactgggatgtgctgattcgggcccgagcc
atcgaaacccagtgctatctgctggcggccgcacaaggtggtgtgcacccggggccgcgg
gaaacctatggacatggggcgattgtcgacccgtggggacgtgtactggcacaacaggat
caaggcgaagcggtgttgttggccgagcgcgatagcagcgaacaagcgtcgatacgggcg
cgcatgccggtggcaggccaccggcgctttttttcgcagggcgcacagcgacctgcttca
gaacgatga

DBGET integrated database retrieval system