KEGG   Pseudomonas fluorescens UK4: HZ99_20400Help
Entry
HZ99_20400        CDS       T03319                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00010  Glycolysis / Gluconeogenesis
pfn00020  Citrate cycle (TCA cycle)
pfn00620  Pyruvate metabolism
pfn01100  Metabolic pathways
pfn01110  Biosynthesis of secondary metabolites
pfn01120  Microbial metabolism in diverse environments
pfn01130  Biosynthesis of antibiotics
pfn01200  Carbon metabolism
Module
pfn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HZ99_20400
   00020 Citrate cycle (TCA cycle)
    HZ99_20400
   00620 Pyruvate metabolism
    HZ99_20400
Enzymes [BR:pfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HZ99_20400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C HlyD_3 NQRA CAT DUF2254 DEC-1_N FAP
Motif
Other DBs
NCBI-ProteinID: AIG04430
UniProt: A0A379I808
Position
complement(4470161..4471804)
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGSGEGEVIELFVKVGDTVEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELEIEGAADAAPAAAPAAAAAPAPAPAEKPAEAPAAPAAAPAAATVQD
IHVPDIGSSGKAKIIELLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLED
EVGTGDFILKLKVQGTAPAAAPAPAAAPAAKAEAAPAAAPAPAPAAKAEAAPAPAAAPAP
SGAKAHAGPAVRQLAREFGVELSAVSPTGPHGRVLKEDVQVYVKSMMQKAKEAPAAGAAT
GGSGIPPIRTVDFSRFGETEEVPMTRLMQIGAAGLHASWLNIPHVTQFDQADITDLEAFR
VAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKAIIRKKYVHIGFAVDTP
DGLLVPVIKNVDQKSLLQLAGEAAALAAKARDKKLTPDDMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLLN
DIRTILL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaagtaatcgagctg
tttgtgaaggtcggcgacaccgtcgaagccgaccagagcatcctgaccctggaatcggac
aaggcgagcatggaaatccctgctcccaaggccggcgtggtcaagagcctgaaagtgaag
ctgggcgaccgcctgaaagaaggcgacgaactgctggagctggaaatcgaaggtgctgcc
gatgcagctcctgcggcggcgcctgctgccgctgctgcacctgcacctgcacctgctgaa
aaaccagccgaagcgcctgccgctccggctgctgcacctgccgccgcgacggtccaggac
attcatgtcccggacatcggctcgtcgggcaaggccaagatcatcgaactgctggtcaag
gtcggcgacaccgtcgaagccgaccagtcgctgatcaccctggagtccgacaaggcctcc
atggaaatcccgtcgccggctgccggcgtggtggaaagcatcgcagtcaagctcgaagac
gaagtcggcactggcgacttcatcctcaagctgaaagtacaaggcactgcacctgctgca
gccccagccccggccgccgctccagcggccaaggctgaagctgcaccggccgccgccccg
gctcctgcgcctgcggcaaaagccgaggccgctccggccccggctgctgccccagcgcca
agcggtgccaaggctcacgccggccctgccgtgcgtcagctggcccgtgaattcggcgtc
gagctgagcgctgtcagccctaccggcccgcatggtcgcgtgctcaaggaagacgtgcag
gtctacgtcaagtccatgatgcaaaaagccaaggaagctccggctgccggcgctgctacc
ggtggctcgggcattccgccgatccgcaccgtggacttcagccgcttcggcgaaaccgaa
gaagtgccgatgacccgcctgatgcaaatcggcgcagccggtctgcacgccagctggttg
aacattccccacgtgactcagttcgaccaggccgatatcaccgacctggaagctttccgc
gtagcgcagaaagccgtggccgagaaggccggcgtgaaactgaccgtactgccactgttg
ctcaaggcctgcgcgcacctgctcaaggaactgccggacttcaacagttcgctggccccc
agcggcaaggcgatcattcgcaagaaatacgtgcacatcggctttgcggtcgacaccccg
gatggcctgctggtacctgtgatcaagaacgtcgaccagaagagcctgctgcagcttgct
ggcgaagcggctgcactggctgccaaggcccgcgacaagaagctgacgccggacgacatg
caaggcgcctgcttcaccatctccagcctcgggcacattggcggcactggcttcacgcca
atcgtcaacgcgccggaagtggcgatcctgggtgtttccaaggccaccatccagcctgtg
tgggacggcaaggccttccagccgaagctgatgctgccgctgtcgttgtcctacgatcac
cgcgtgatcaatggcgcggctgccgcacgtttcactcagcgcctgagccagttgctgaac
gatatccgcaccatcctgctgtaa

DBGET integrated database retrieval system