KEGG   Pseudomonas fluorescens UK4: HZ99_25670Help
Entry
HZ99_25670        CDS       T03319                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00480  Glutathione metabolism
pfn00590  Arachidonic acid metabolism
pfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    HZ99_25670
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HZ99_25670
Enzymes [BR:pfn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HZ99_25670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AIG05409
UniProt: A0A379IAE5
Position
5596881..5597426
Genome map
AA seq 181 aa AA seqDB search
MLMRWLAVPALMVAFGGVAMAADCPPLLEGQLPKLRAKESIDLCQRFAGKPLVIVNTASF
CGFAPQFKGLEALYQRYKGDGLEVIGVPSDDFKQEAKTGEETAKVCYVNYGVTFTMTEPQ
KVRGPDAAHLFKVLAEQSNAPKWNFYKYVVDRQGKVVASFSSLTKPDSPELIEAVERALA
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgcgctggctcgcagtacctgccctgatggtggcttttggcggtgtcgccatg
gccgccgattgcccgccgttgctcgaaggccaattgcccaagttgcgcgccaaggaatcc
atcgacctgtgccagcgttttgccggcaagcccctggtcatcgtcaacaccgccagtttt
tgtgggttcgccccgcagttcaaaggcctggaggcgctgtatcagcgctacaagggcgat
ggcctggaagtgattggcgtgccctccgacgacttcaagcaggaagccaagaccggcgag
gagaccgccaaggtttgctatgtgaactacggcgtgaccttcaccatgaccgagccgcag
aaggtcagggggcccgatgcggcacacctgttcaaggtcctggccgagcagagcaatgcg
ccgaagtggaatttctataagtacgtggtggatcgccaaggtaaggtggtcgccagtttc
tccagcctgaccaagccggacagtccggaactgatcgaggccgtagagcgggcactggct
ttgtag

DBGET integrated database retrieval system