KEGG   Pseudomonas fluorescens UK4: HZ99_25770Help
Entry
HZ99_25770        CDS       T03319                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00360  Phenylalanine metabolism
pfn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfn00790  Folate biosynthesis
pfn01100  Metabolic pathways
pfn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HZ99_25770 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HZ99_25770 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HZ99_25770 (phhA)
Enzymes [BR:pfn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     HZ99_25770 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIG05429
UniProt: A0A379IAG6
Position
complement(5618269..5619060)
Genome map
AA seq 263 aa AA seqDB search
MKQTQYVAREPDAQGFIHYPPEEHAVWNTLITRQLKVIEGRACQEYLDGIDKLGLPHDRI
PQLAQINKVLAETTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLAATKEQRVYLARLYWMTIEFGLVDTPEGRRIYG
GGILSSPKETVYCLSDEPKHQAFDPLEAMRTPYRIDILQPLYFVLPSLKRLFEVAQEDIM
GMVERGMQLGLHAPLFPPKPKAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgcaatacgtggcccgcgagcccgatgcgcaaggttttatccactacccg
cccgaagaacatgcggtgtggaacaccctgatcactcgccagctgaaagtgatcgagggt
cgcgcctgccaggaatacctggacggcatcgacaaactcggcctgccccatgaccgcatt
ccgcaactggcgcaaatcaacaaagtgctggccgaaaccaccggctggcaagtggcgcgg
gtgccggcactgatccccttccagaccttctttgaattgcttgccagcaagcagtttccg
gtggcgacctttattcgcacccgtgaagagctggactacctgcaagaaccggatattttc
cacgagattttcggccactgcccactgctgaccaacccctggttcgccgaattcacccac
acctacggcaagctcggcctcgcggccaccaaggagcaacgggtgtacctggcgcgcctg
tactggatgaccatcgagttcggcctggtggacacgcctgaaggtcggcgcatctacggt
ggcggcatcctgtcgtcgcccaaggagacggtgtactgcctctcggatgagcccaagcac
caggccttcgacccgctggaagccatgcgcacgccgtatcgcatcgacatcctgcagccg
ctgtatttcgtcctgcccagcctcaagcgcctgtttgaagtggcccaggaagacatcatg
ggcatggtcgagcgcggtatgcagttgggtctgcacgcgccgctgttcccgcccaagccc
aaggcggcttga

DBGET integrated database retrieval system