KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0871Help
Entry
Pfl01_0871        CDS       T00283                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00340  Histidine metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Pfl01_0871
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pfl01_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABA72614
UniProt: Q3KHZ2
Position
1016337..1017662
Genome map
AA seq 441 aa AA seqDB search
MTAPTAIRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQK
FDGLEVASMADLILPRERLELALTRITVAQREALEKAAARVRSYHEKQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPQVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDR
ATIIETSINGRGALIHVRDMAQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEAGASELGKTASILARG
ESLSAHARSAEYRIKDDVKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccgactgcaattcgccgactcaacgctgctgacccggatttcgcgcatcat
ctggatcatctgctgagctgggaaagtgtgtctgacgactcggtcaatcagcgggtgctg
gacatcatcaaggctgtgcgcgagcgcggtgacgcggcgctggtcgagttcacccagaaa
ttcgacggcctcgaagtcgcctccatggcagacctgatcctgccgcgcgagcgtctggaa
ctggccctgacccgtatcaccgtggctcaacgcgaagcgctggaaaaagccgccgcccgt
gtgcgcagctatcacgaaaaacagaagcaggactcctggagctacaccgaagccgacggc
accgtgctgggccagaaggtcacgccgctggatcgcgccggtctgtatgtgccgggcggc
aaggcgtcgtacccgtcgtcggtgttgatgaatgcgattccggccaaggtcgctggcgtg
actgaagtggtcatggtggtgccaaccccgcgtggcgaggtcaacgaactggtgctggcg
gcggcgtgcattgccggcgtcgaccgggtgttcaccatcggtggcgcacaagccgttgct
gcgttggcctatggcaccgaaagcgtgccgcaggtggacaaggtcgtcggcccgggcaac
atctatgtcgccactgccaagcgtcacgtgttcggtcaggtcggcatcgacatgattgcc
ggcccgtctgaaatcctcgtggtgtgcgacggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaagacgcccaggcgattctggtcagcccggac
gccgagttcctcgacaaggtcgccgcgagcatcgacaagctgctgccgaccatggatcgc
gcaaccatcatcgaaacctcgatcaacggccgtggtgccctgattcacgtgcgcgacatg
gcccaggccatcgaagtcgccaaccgcattgccccggaacaccttgagctgtcggtcgcc
gaccctcaggcctggctgccgcagatccgccacgccggcgcgattttcatgggccgccac
acctccgaggcgctgggcgactactgcgcgggtccgaaccacgtgctgccgacctccggc
actgcgcgtttctcttcgccgctgggcgtgtacgacttccagaaacgctcgtcgatcatc
ttctgctccgaggccggcgcttcggagcttggcaagactgcatcgattctggcccgtggc
gaatcgctgagcgcccacgcgcgtagcgccgaataccgcatcaaagacgacgtgaagggg
aactga

DBGET integrated database retrieval system