KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1835Help
Entry
Pfl01_1835        CDS       T00283                                 

Definition
(GenBank) putative hydratase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Pfl01_1835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pfo01002]
    Pfl01_1835
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     Pfl01_1835
Peptidases [BR:pfo01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   Pfl01_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABA73578
UniProt: Q3KF78
Position
complement(2053595..2054281)
Genome map
AA seq 228 aa AA seqDB search
MALQIGFLLFPQVQQLDLTGPYDVLASLPDVQVHLVWKDLVPVTSSTGLQLKPTTTFEDC
PVLDVICVPGGAGVGPLMEDEQTLDFIRSQAAQARYVTSVCTGSLVLGAAGLLQGKRATT
HWAYHDLLPTLGAIPVKDRVVRDGNLFTGGGITAGIDFALTLAQELVGVDTAQLVQLQLE
YAPAPPFDSGSPDTAPSTVVDEARKRAAPSLKLRTEITERAAAKLNLR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcagatcggttttctgttgtttccccaggtgcagcaactcgacctgaccggc
ccgtatgacgtgctggcctctctgccggacgtgcaggtgcatctggtctggaaggatttg
gtgccggtaacttccagcaccgggctgcagctgaaaccgaccactacgttcgaggactgc
ccggttttggacgtgatctgcgtacccggcggcgccggggtcgggccgttgatggaggat
gagcagacgctggacttcatcaggtcgcaagcggcacaggctcggtacgttacgtcggtt
tgcaccggttcgcttgtgcttggcgcggcgggtctgttgcaaggtaaacgggcgactacg
cactgggcatatcacgatttgctgccgacactgggcgcgattccggtgaaggatcgggtg
gtgcgtgacggcaatctgtttaccgggggcggcatcaccgccgggatcgattttgccctg
acactggcgcaggaactggtcggtgtcgatacggcgcaactggtgcagttgcagctggaa
tacgcgccggcgccgccatttgattcgggcagcccggacacggcgccgagtactgttgtc
gatgaggcgcgcaagcgtgcggcgccttcattgaagttgcgcactgaaatcaccgagcgt
gctgcggcgaagctcaatctgcgctga

DBGET integrated database retrieval system