KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2843Help
Entry
Pfl01_2843        CDS       T00283                                 

Definition
(GenBank) putative formyl transferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00520  Amino sugar and nucleotide sugar metabolism
pfo01100  Metabolic pathways
pfo01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pfo_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_2843
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Pfl01_2843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pfo01005]
    Pfl01_2843
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     Pfl01_2843
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     Pfl01_2843
Lipopolysaccharide biosynthesis proteins [BR:pfo01005]
 Unusual sugar
  Pfl01_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C NAD_binding_10 3Beta_HSD NAD_binding_4 TrkA_N RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABA74584
UniProt: Q3KCC1
Position
3280042..3282048
Genome map
AA seq 668 aa AA seqDB search
MSAKTVVFAYHDIGCAGIQALLDSGYDIAAVFTHAHDPKENTFYASVAQLCANNGIAVHA
PEDANHPLWIERIAKLDPDYIFSFYYRNLLSEPLLALAKKGAFNLHGSLLPRYRGRAPAN
WVLVNGETETGVTLHRMVKRADAGAIVAQQRVAIERSDTALSLHGKLRTAASDLLRDALP
AMLQGRITETPQDESKATVFGRRTPADGKLVWAQPAEKLFNLVRAVTQPYPGAFCAVGEH
KLIVWSAEVVKGNEGQAPGRVISVDPLRIACGEDSLVINAGQRNDNGLYLSGPQLANELG
LVDGSLLRGAESGRGPRRTRVLILGVNGFIGNHLSERLLRDERYEVYGLDIGSDAIDRLR
SHPRFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKLV
RYCVKYNKRVIFPSTSEVYGMCQDKHFDEDRSNLIVGPINKQRWIYSVSKQLLDRVIWAY
GAKGLNFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILNLVEGTPIRLFDGGEQKRCFT
DIADGVEALARIIDNDNDVCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRSNFPPFA
GFRDVESKAFYGAGYQDVEHRKPSIANAKRLLDWTPTVEMRETIGNTLDFFLREAMLEIE
RPSNKEAC
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaaccgttgtcttcgcttaccacgatattggctgcgccggcattcaagcc
ctgctcgacagtggctatgacattgcggcggtgtttacccatgcccatgaccccaaggag
aacaccttctacgcctcggtcgcgcaactgtgcgccaacaacggcatcgcggttcatgca
ccggaagacgccaaccatccgctgtggatcgagcggatcgccaagctcgatccggattac
atcttctcgttctactatcgcaacctgctgagcgagccgctgctggcgctggccaaaaaa
ggcgcgttcaacctgcacggctccttgttgccgcgctaccgtggccgcgctccggccaac
tgggtgctggtcaacggcgaaaccgaaaccggtgtcaccctgcaccgcatggtcaaacgc
gccgacgccggcgccatcgtcgcccaacaacgtgtagccatcgaacgcagcgacaccgcg
ctgagcctgcacggcaaactgcgcacggccgccagcgacctgctgcgcgacgcgctgcca
gcgatgcttcagggcagaatcaccgagaccccgcaagacgaatccaaagccaccgtgttc
ggtcgccgtaccccggcggacggcaaactggtctgggcgcaaccggccgaaaaactgttc
aacctggtgcgggccgtgactcagccctaccccggcgccttctgcgccgtgggcgagcac
aagctgatcgtctggagtgccgaagtcgtcaagggcaacgaaggtcaggcgccgggccgc
gtcatcagtgtcgatccgctgcgcatcgcctgcggtgaagactcgctggtgatcaacgcc
ggccagcgcaacgacaacggcctgtacctcagcggcccgcaactggccaatgaactcggt
ctggtggacggttcgctgctgcgcggtgccgagtccggccgtggcccgcgccgcacacgg
gtgctgatcctcggcgtcaacggtttcatcggcaaccatctgtccgagcgcctgctgcgt
gacgagcgctacgaagtctatggcctggacatcggttccgacgccatcgaccgcctgcgc
agccacccgcgttttcacttcgtcgaaggcgacatcagcattcactcggagtggatcgag
taccacatcaagaaatgcgacgtggtgctgccgctggtggccatcgccacgccgatcgaa
tacacgcgcaacccgctgcgggtgttcgaactcgacttcgaagaaaacctgaaactggtg
cgctactgcgtcaaatacaacaagcgagtgatcttcccgtcgacctcggaagtctatggc
atgtgccaggacaagcacttcgacgaagaccgctcgaacctgatcgtcggcccgatcaac
aagcagcgctggatctactcggtatcgaagcaactgctggaccgggtgatctgggcctac
ggcgccaagggcctgaacttcaccctgttccgtccattcaactggatgggcccacggctg
gatcgcctcgattcggcacgcatcggcagctcccgcgccattacccagttgatcctcaac
ctggtggaaggcacgccgatccgcctgttcgacggcggcgagcagaagcgctgcttcacc
gacatcgccgacggcgtcgaagcactggcgcggatcatcgataacgacaacgacgtctgc
aacggccagatcatcaacatcggcaacccggacaacgaagcgagcatccgccagttgggc
gaagaactgctgcgccagttcgaggctcacccgttgcgcagcaacttcccgccgttcgcc
ggtttccgcgacgtggaaagcaaggcgttctacggtgccggttatcaggacgtcgagcac
cgcaagccgagcatcgccaacgccaagcgcctgctggactggacgccgaccgtcgaaatg
cgcgagaccatcggcaacacgctggacttcttcctgcgcgaggccatgctcgaaatcgag
aggccttccaacaaagaggcatgctga

DBGET integrated database retrieval system