KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2868Help
Entry
Pfl01_2868        CDS       T00283                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00071  Fatty acid degradation
pfo00072  Synthesis and degradation of ketone bodies
pfo00280  Valine, leucine and isoleucine degradation
pfo00310  Lysine degradation
pfo00362  Benzoate degradation
pfo00380  Tryptophan metabolism
pfo00620  Pyruvate metabolism
pfo00630  Glyoxylate and dicarboxylate metabolism
pfo00640  Propanoate metabolism
pfo00650  Butanoate metabolism
pfo00900  Terpenoid backbone biosynthesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
pfo01200  Carbon metabolism
pfo01212  Fatty acid metabolism
pfo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pfl01_2868
   00630 Glyoxylate and dicarboxylate metabolism
    Pfl01_2868
   00640 Propanoate metabolism
    Pfl01_2868
   00650 Butanoate metabolism
    Pfl01_2868
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pfl01_2868
   00072 Synthesis and degradation of ketone bodies
    Pfl01_2868
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pfl01_2868
   00310 Lysine degradation
    Pfl01_2868
   00380 Tryptophan metabolism
    Pfl01_2868
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pfl01_2868
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pfl01_2868
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pfl01_2868
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfo04147]
    Pfl01_2868
Enzymes [BR:pfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pfl01_2868
Exosome [BR:pfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pfl01_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: ABA74609
UniProt: Q3KC96
Position
complement(3308298..3309488)
Genome map
AA seq 396 aa AA seqDB search
MTISNDPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGVAADAVDEVLFGCV
LPAGLGQAPARQAALGAGLDKSTRCTTVNKMCGSGMETAILAHDMLLAGSADVVIAGGME
SMSNAPYLLDRARAGYRMGHGRVLDSMFLDGLEDAYDKGRLMGTFAEDCAETNDFSREAQ
DAFAIASTTRAQQAIKDGSFKDEIVPLTVTVGKEQVVISNDEQPPKAKLDKIASLKPAFR
EGGTVTAANSSSISDGAAALVLMRQSQAQKQGLKPLAVIHGHAAFADTPGLFPVAPIGAI
KKLMKKTGWSLDQVDLFEVNEAFAVVGMAAMTHLEIPHDKLNIHGGACALGHPIGASGAR
ILVTLLSALRQKGLKRGVAAICIGGGEATAMAVECV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctccaacgatccgattgtcatcgtcagcgccgtccgcaccccgatgggcggt
ttccagggcgaactgaaaagcctgaccgcgccgcaactgggcgccgctgcaatcaaggcg
gcggttgagcgtgccggtgtggccgccgatgcggtcgatgaagtgttgttcggctgcgtg
ttgccggccggtcttggtcaggcgcctgcacgtcaggctgcactgggcgccgggctggac
aagtccacccgctgcaccacggtcaacaagatgtgcggttcgggcatggaaaccgccatt
ctggcccacgacatgctgctggctggcagcgccgatgtggtgatcgccggcggcatggaa
agcatgtccaacgcgccgtatctgctggatcgcgcccgtgccggttaccgcatgggccac
ggccgggtgctggattcgatgttcctcgacggcctcgaagacgcctatgacaagggccgc
ctgatgggcaccttcgccgaggattgcgccgaaaccaacgacttcagccgtgaagcgcag
gacgcctttgccatcgcctcgaccacccgcgcccagcaggcgatcaaggacggcagcttc
aaggacgaaatcgttccgctgaccgtgaccgtcggcaaggaacaggttgtgatcagcaac
gatgagcagccaccaaaagccaagctggacaagattgcttcgcttaaaccggcgttccgc
gaaggcggcaccgtgaccgctgccaactccagctcaatctctgacggcgccgctgcgctg
gtgctgatgcgtcagtcgcaagcacaaaagcagggtctgaagccgctggcggtgattcac
ggacacgcggcgtttgccgacaccccgggcctgttcccggtggcaccgattggcgcgatc
aagaagctgatgaagaaaaccggctggtcgctggatcaggtcgatctgttcgaagtcaac
gaagccttcgccgtggtcggcatggcggcgatgacccacctggaaatccctcacgacaag
ctcaacatccatggcggcgcctgcgccctcggtcacccgatcggtgcgtccggcgcgcgg
attctggtgactttgctctcggccctgcgccagaaaggcctgaaacgcggcgtcgcggcg
atctgcatcggcggcggcgaagccacggcgatggctgtcgagtgcgtctga

DBGET integrated database retrieval system