KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2874
Entry
Pfl01_2874        CDS       T00283                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16301  deferrochelatase/peroxidase EfeB [EC:1.11.1.-]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfo02000]
    Pfl01_2874
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     Pfl01_2874
Transporters [BR:pfo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Pfl01_2874
SSDB
Motif
Pfam: Dyp_perox PsbQ
Other DBs
NCBI-ProteinID: ABA74615
UniProt: Q3KC90
Position
3315511..3316809
AA seq 432 aa
MNDSEHFNLQRRRVLMGMGAAGVALAGTALSCPAMAAAPAQVTEAPSSDKTQDHHDFHGV
HQTGIVTPRPAAGMLVSFDVLASDREDLERLFRTLNERIAFLMKGGPVAQIDPKLPPPDS
GILGPVVTPDNLTITVSVGESLFDERFGLAAAKPKRLVRMVGFPNDALEADCCHGDLSLQ
FCSNTADTNIHALRDIVKNLPDLLLVRWKQEGSVPPQAPAKPGVPAQSARNFLGFRDGSA
NPDSNDGKAMDRIVWVQPGSDEPAWAAHGSYQAVRIIRNFVERWDRTPLQEQESIIGRVK
TTGAPMGASHETEVPDYSKDPEGKLTKLDAHIRLANPRTAASQANLILRRPFNYSNGVNK
NGQLDMGLLFICYQADLEKGFITVQTRLNGEPLEEYLKPVGGGYFFTLPGVTGDKDFIGR
SLLNATQPKTTA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaacgattccgaacacttcaacctgcaacgtcgccgcgtactgatgggcatgggcgcc
gccggtgtcgcactggccggcaccgctttgagttgcccggcgatggccgccgcgcctgcg
caagtgaccgaagcgccgagcagcgacaagacccaggatcaccacgatttccatggcgtg
caccagactggcatcgtcaccccgcgtccggcggccggcatgctggtgtcgttcgatgtg
ctggccagcgaccgtgaagacctggagcggctgttccgcaccctcaacgagcgcatcgcg
ttcctgatgaaaggcggcccggtggcgcagatcgatccgaagttgccgccgccggattcc
ggaatcctcggcccggtggtgacgccggacaacctgaccatcaccgtgtccgtcggcgag
tcactgttcgacgagcgcttcggtctggccgccgccaaacccaagcgtctggtgcgcatg
gtcggtttccccaacgatgcgctggaagccgattgctgccacggcgatttgagcctgcag
ttctgttccaacaccgccgacaccaacatccacgccctgcgcgacatcgtgaaaaacctg
ccggacctgctgctggtgcgttggaaacaggaaggcagcgtgccgccgcaagcgccggcc
aaacccggtgtgccggcgcaatcggcgcgtaacttcctgggttttcgcgacggttcggcc
aacccggattccaacgacggcaaggccatggatcgcatcgtctgggtgcaaccgggcagc
gacgaaccggcctgggcggcccacggcagttatcaggcggtgcgaatcatccgcaacttc
gtcgaacgctgggaccgcacgccgttgcaggaacaggaaagcatcatcggccgggtgaaa
accaccggcgcgccgatgggcgccagccatgaaaccgaagtcccggattacagcaaggac
ccggaaggcaagctgaccaagctcgacgcgcacattcgcctggccaatccgcgcaccgcc
gcgagccaggccaacctgatcctgcgccggccgttcaactactccaacggggtgaacaag
aacggccagctcgacatgggcctgctgttcatctgttaccaggccgacctggaaaaaggc
ttcatcaccgtgcagacccgcctcaacggcgaaccgctagaggaatacctcaagccggtc
ggcggcggttacttcttcaccctgccgggtgtcacgggcgacaaggacttcatcggtcgc
tcgctgctcaacgctactcaaccaaaaacaactgcatag

DBGET integrated database retrieval system