KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2882Help
Entry
Pfl01_2882        CDS       T00283                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00071  Fatty acid degradation
pfo00280  Valine, leucine and isoleucine degradation
pfo00281  Geraniol degradation
pfo00310  Lysine degradation
pfo00360  Phenylalanine metabolism
pfo00362  Benzoate degradation
pfo00380  Tryptophan metabolism
pfo00410  beta-Alanine metabolism
pfo00627  Aminobenzoate degradation
pfo00640  Propanoate metabolism
pfo00650  Butanoate metabolism
pfo00903  Limonene and pinene degradation
pfo00930  Caprolactam degradation
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
pfo01212  Fatty acid metabolism
Module
pfo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pfl01_2882
   00650 Butanoate metabolism
    Pfl01_2882
  Lipid metabolism
   00071 Fatty acid degradation
    Pfl01_2882
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pfl01_2882
   00310 Lysine degradation
    Pfl01_2882
   00360 Phenylalanine metabolism
    Pfl01_2882
   00380 Tryptophan metabolism
    Pfl01_2882
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pfl01_2882
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pfl01_2882
   00281 Geraniol degradation
    Pfl01_2882
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pfl01_2882
   00627 Aminobenzoate degradation
    Pfl01_2882
   00930 Caprolactam degradation
    Pfl01_2882
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pfl01_2882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABA74623
UniProt: Q3KC82
Position
complement(3323358..3324170)
Genome map
AA seq 270 aa AA seqDB search
MTQYTAFSVELADNIAHVQINRPEKINSMNAAFWSEIVEVFQWIDDTDEVRVVVLSGAGK
HFSSGIDLMMLAGVANELGKDVGRNARLLRKKILTLQASFNAVDNCRKPVLAAIQGYCLG
GAIDLIAACDMRYAAEDAQFSIKEIDIGMAADVGTLQRLPRIIGDGMLRELAYTGRTFGA
EEARSIGLVNRVYSDKDGLIEGVMDIARDIAGKSPIAVTGTKEMISYMRDHRIDDGLEYV
ATWNAAMLQSNDLRVAMAAHMSKQKPEFLD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatacaccgccttcagcgtcgaactggccgacaacatcgcccatgtgcagatc
aatcgtccggaaaagatcaactcgatgaacgccgcgttctggagcgaaatcgtcgaggtg
ttccagtggatcgacgacaccgacgaagtgcgggtggtggtgctcagcggtgccggtaaa
catttctcctcgggcatcgacctgatgatgctggccggtgtggccaatgagctgggcaag
gacgtgggccgcaatgcgcgcctgctgcgcaaaaagatcctgaccctgcaagcctcgttc
aatgcggtcgacaattgccgtaaaccggtactcgcggcgatccagggttattgcctgggc
ggcgctatcgacctgatcgccgcctgcgacatgcgctacgccgccgaagacgcgcaattc
tcgatcaaggaaatcgacatcggcatggcggctgacgtcggcaccttgcaacggttgcca
cggatcatcggtgacggcatgctgcgtgaactggcttacaccggtcgcacctttggcgcc
gaagaagcgcgcagcatcggcctggtcaatcgcgtctacagcgacaaggacggcttgatc
gaaggcgtgatggacattgcccgggacatcgccggcaagtcgccgatcgcggtcaccggc
accaaggaaatgatcagctacatgcgcgaccatcgcattgacgacggtctcgagtacgtt
gccacctggaacgccgccatgctgcaatccaacgatttgcgcgtggccatggccgcccat
atgagcaaacagaaacccgaatttctggattga

DBGET integrated database retrieval system