KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3010
Entry
Pfl01_3010        CDS       T00283                                 
Name
(GenBank) putative transglycosylase protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB
Motif
Pfam: SLT DUF3404
Other DBs
NCBI-ProteinID: ABA74748
UniProt: Q3KBV6
Position
3449720..3450235
AA seq 171 aa
MLTMLAAQADELPPPAYQLAAHDADIPSTVLFAIALQESGIRVHGRLLPWPWTLNIAGNP
YRFATRQAACHALLQALTQYDAKRVDAGLGQTNLGYHGQRFSSPCDALDPYRNLAVTAAL
LQEHHTATGDWVSAAGRFHRPAGGTPAARYRAGFSRQLERLLVSFKQGTPP
NT seq 516 nt   +upstreamnt  +downstreamnt
atgctgacgatgctcgcagcccaggctgacgaacttccgccgcctgcctaccaactggcg
gcgcatgacgcggacatcccttctacggtgctgttcgcgattgccctgcaggagagcggc
attcgggtccatggccgactgctgccctggccttggactctgaacatagccggtaaccct
taccgcttcgccactcgccaggccgcctgtcacgccttgctccaggcactcactcagtat
gacgccaagcgggtcgacgccggacttgggcaaaccaacctgggttaccacggacaacgt
ttttccagcccctgcgatgccctcgacccgtaccgaaatctcgccgtgaccgccgcgctg
ttgcaggagcatcacaccgccaccggtgactgggtgtctgctgccggacgctttcaccgc
ccggcaggaggaacgccggccgcgcgttaccgcgccggattttcccggcaactcgaacgg
ttgctggtttccttcaaacagggcacaccgccatga

DBGET integrated database retrieval system