KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3018Help
Entry
Pfl01_3018        CDS       T00283                                 

Definition
(GenBank) putative membrane protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 ExoD TraL
Motif
Other DBs
NCBI-ProteinID: ABA74756
UniProt: Q3KBU8
Position
3455601..3456014
Genome map
AA seq 137 aa AA seqDB search
MNDTIERVADGTLVFLPERLNRDPAVLRGLTNDEIWVALGAGAVIGLLLGVPLAIATATI
AVAPTSMIAGMALVLLAGGTLLRRTKRARPETWLYRKLEWVLASRWRLGRGSLILHSGAW
TVRRSRRLRPALSRWQL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacactatcgaacgcgttgccgacggcaccttggtctttctgcccgagcgactc
aatcgtgatcccgccgtattacgcggtttgaccaatgatgagatttgggtggcgctcggc
gccggcgccgtcattggcctgctgctgggcgttcccctggcaatcgccaccgctaccatt
gccgtggcgccgaccagcatgatcgcgggcatggcgctggtgttacttgccggcggcaca
ctactgcgtcggaccaaacgggcccgccccgagacctggttgtaccgcaagctcgaatgg
gtactggcgagtcgttggcgcctggggcgcggaagtttgattctccactctggcgcctgg
acggttcgccgttcgcgtcgactgcgcccggccctgtcccggtggcaactatga

DBGET integrated database retrieval system