KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3019
Entry
Pfl01_3019        CDS       T00283                                 

Definition
(GenBank) putative membrane protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ABA74757
UniProt: Q3KBU7
Position
3456011..3456652
AA seq 213 aa
MSRFRNKVDAQQAHIVSLRLAVVILALLCAGLWYGWRSAPTDLTVHVPPDLRSGSTRKWW
DIPSENVYAFALYIFGQLNRWPSDGEQDYRRAIYGLQSYLTPSCKAFLEGDYEYRKAAGE
LRQRVRGVYEILGRGYSEDPELRVKQLDRDSWLVKLDLNADEYYSAEPVKRVVVRYPLRV
VRFDQDPERNKWGLALDCYQGTPQKISLPGGEP
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagtcgctttcggaacaaggtcgatgcccaacaggcccacatcgtcagcctgcgcctg
gcggtagtgatcctcgccctgctctgtgccggactctggtatggctggcgctcggcaccg
accgatctgaccgtgcatgtccccccggatctgcgctcgggcagcactcgcaagtggtgg
gatatcccctcggagaatgtgtatgcctttgccctgtacatctttggtcagctcaaccgc
tggccctcagatggcgagcaggactatcgccgcgccatctatggcttgcagtcctacctg
acaccctcctgcaaggccttcctcgaaggcgactacgaataccgcaaggccgccggcgaa
ctgcgccagcgggtgcgtggcgtctacgaaattctgggtcgaggttacagtgaggatccg
gaactcagggtcaagcaactcgaccgcgacagctggttggtcaagctcgacctcaatgcc
gatgaatattactccgcggaaccggtgaaacgggtggtggtgcgttatccattacgcgta
gtgcgtttcgaccaggatcccgagcgcaataaatgggggctggcactggattgttatcag
ggcactccgcaaaaaatctccctgcctggaggtgagccatga

DBGET integrated database retrieval system