KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3023
Entry
Pfl01_3023        CDS       T00283                                 
Name
(GenBank) putative VirB4 Type IV secretory pathway protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE AAA_22 DUF87 AAA_29 T2SSE AAA_10 TrwB_AAD_bind Tet_res_leader
Other DBs
NCBI-ProteinID: ABA74761
UniProt: Q3KBU3
Position
3459347..3462100
AA seq 917 aa
MRTGDSSNRTPAWKAWRNPLRPRATLADDAALYTHNPSFTDHLPWVEYLDTEQCFLLDDN
RSVGAVFELLPIGTEGREPDWLMAARDALEDALQDSFDELDQAPWVAQFFCQDDNDLTPY
LTRLNDYIQDRARGTVFTEAYLELTRRHLKAIAKPGGLFEDNAVTRLPWRGNNRRVRLVV
YRWLESDDEETGLTPVQSLHEACERIAASLQACGVQSVRVDGRGLYAWLVPWFNPAPQLT
DEAPEEFYRRVAYPESGDGESLELPFDHDFAERLFFNEPRSDVQHGLWFFDDQPHRVMVV
DKLRRAPLIGQLTGETRKGDAVNALFDQLPEGTVVSLTLVAKPQDVLEDQLNRLARKAIG
ENLASTQTRQDVEEARAIIGRQHKLYRGTLAFYVRGHDELQLHQRSVSLANALLGAGLQP
VREGDEVAACNSYLRWLPMAYNPARDTRNWYTRLMFAQHLANLVPVWGRSTGTGHPGITL
FNRGGSPLSFDPLSRLDRAMNGHLLLFGPTGAGKSATLVTLLMQVMAVYRPRLFIVEAGN
SFGLQGDYFATQGLSVNKVQLKPGASVSLAPFADAWRLVEQPDQVASLSIDELDDEVVTS
REDQRDVLGELEITARLMITGGEAKEEARLSRADRSLIRECILDAAQTCVAANRQVLTRD
VRNALLRVAADLHLPEKRRERAQEMGESIDLFCQGFEGELFDREGTPWPESDVTIVDLAT
YVREGYEAQMSISYISLMNTVNNLAERDQYLGRPIIMVTDEGHIITKNPLLTPFVVKGTK
MWRKLGAWFWLATQNLADFPTAAQTMLNMIEWWICLNMPPAEIEEIARFKKLTPAQKALL
LSASKEPGKYTEGVVLSKKLETLFRAVPPSLYLALAMTEPEEKAERWTLMQENGCSELEA
AYRVAERIDRARGIEPA
NT seq 2754 nt   +upstreamnt  +downstreamnt
gtgcgtaccggcgattcgagcaaccgcactcctgcgtggaaagcctggcgcaacccattg
cgccctcgcgccaccttggccgatgacgccgcactctatacgcacaaccccagcttcacc
gatcacctgccttgggtcgagtacctcgacaccgagcaatgttttctgctcgatgacaat
cgttcggtgggcgcggtgttcgagttactgcccatcggcaccgaagggcgcgaacccgat
tggctgatggcggcccgcgatgcccttgaggatgccctgcaggatagctttgacgagctg
gatcaagcgccttgggtagcgcagtttttctgccaggacgacaacgatttaaccccctat
ctgacccgactcaacgattatattcaggacagagcgcgaggtacggtgttcaccgaagcg
tacctggaacttactcgccgacatctgaaggccatcgccaagccgggcggtctgttcgaa
gacaacgcagtcacgcgcctaccctggcgcggaaacaaccgccgggtgcgcttggtggtt
tatcgctggcttgagtctgacgacgaggagacaggactcaccccggtgcaatccctgcat
gaggcttgcgaacgtatcgcggcttcgttgcaggcctgcggcgtacaatcggtacgagtc
gatggccgcggtctttatgcctggttagtgccctggttcaatccggccccccagctcacc
gatgaagcgcccgaggagttctaccgccgcgtggcctatccggagtcaggcgacggtgaa
tcgctggaactgccctttgatcatgactttgccgagcggctgttcttcaatgaaccgcgt
tcggatgtgcagcacggactctggttttttgacgatcagccccaccgggtcatggtagtg
gacaagctgcgccgagcgcccctgattggtcaactcaccggagaaacccgcaagggcgac
gcggtgaatgccctgttcgaccagttacccgagggcacggtggtgagcctgaccctggtg
gccaaaccacaggatgtactcgaagaccagttgaaccgcttggcgcgaaaagccatcggt
gaaaatctggcctcgacccagacccgccaagatgtcgaagaggctcgtgcgatcatcggt
cgccagcacaagctgtaccgcggcacgctggcgttctacgtgcgcggtcacgatgaactg
caattgcaccagcgctcggtcagcctggctaacgcgctgctgggtgcggggctgcaaccg
gtacgtgaaggcgatgaagtcgccgcctgcaacagctacctgcgttggttaccgatggct
tacaacccggcgcgcgacacgcgcaactggtacacccgcctgatgtttgcccagcacctg
gcgaatctggttccggtgtggggccgcagcaccggcaccggccacccgggcatcaccctg
ttcaatcggggtggttcgccgttgagttttgatccgttgtcacgtcttgaccgggccatg
aacggccatctgctgttgttcggcccgactggcgccggcaaatcggccaccctggtcacc
ctgctgatgcaggtcatggctgtgtaccgccctcgtctgtttatcgtcgaggccggcaac
tcattcggcttgcagggagactacttcgcgacacagggcctgtcggtcaacaaggtccaa
ttgaaacctggcgcctcggtcagtctcgccccgttcgccgatgcttggcgcctggtcgag
cagccggatcaggtggcgagtctatcgatcgatgagctggacgatgaggtggtaaccagt
cgcgaagaccagcgcgatgttcttggcgaactggaaatcaccgctcggctgatgatcacc
ggcggcgaggccaaggaagaggcccgcctgagtcgagctgatcgcagcttgattcgcgag
tgcattctcgatgcggcgcagacctgtgtcgcagcgaaccgccaggtgctgacccgcgac
gtgcgcaacgctttgctgcgcgtcgccgccgacctgcacttaccggaaaaacgtcgcgaa
cgtgcccaggagatgggcgagtccatcgacctgttttgccagggtttcgaaggggaactg
ttcgatcgcgagggcacgccttggcccgagagcgatgtgaccattgtcgatctcgccact
tacgttcgcgaaggctacgaggcgcagatgtccatcagctatatcagcctgatgaacacc
gtgaacaaccttgccgagcgcgaccagtatctgggccgaccgatcatcatggtcaccgac
gagggccatatcatcaccaagaacccgctattgacgccatttgtggtcaaggggacgaag
atgtggcgcaagctcggcgcttggttctggctcgccacgcaaaaccttgccgattttccc
acggcggcgcagaccatgctcaacatgatcgaatggtggatttgtttgaatatgccgccc
gcggagattgaggaaatcgcacggttcaagaagctcacgccggcgcagaaagccttgttg
ctctccgccagtaaggagccggggaagtacactgagggggtcgtgctgtcgaagaagctc
gagacactgtttcgagccgtgccacccagcctttacctcgccctggccatgaccgagccc
gaggaaaaagccgagcgttggacgctgatgcaggagaacggctgctcagaactggaagcg
gcgtatagggtagctgaacggatcgatagagcgcgaggaatagaacccgcatag

DBGET integrated database retrieval system