KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3097Help
Entry
Pfl01_3097        CDS       T00283                                 

Definition
(GenBank) putative magnesium chelatase protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00860  Porphyrin and chlorophyll metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pfl01_3097
Enzymes [BR:pfo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Pfl01_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA AAA_16 AAA_3 AAA_22 NACHT RuvB_N Imm51
Motif
Other DBs
NCBI-ProteinID: ABA74835
UniProt: Q3KBL9
Position
complement(3546478..3547479)
Genome map
AA seq 333 aa AA seqDB search
MTDTPHFPLSAVVGADDLKLALYLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALSDGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGTNLIERDGISHRHSAKFVLIGTMNPEEGELRPQLLDRFGLNVALSGHTAPAERGQ
IIRRRLDFDSDPQVFCAQWEADQQALRERCESARHALANIPLDDEALAQITERCFAAGVD
GLRADLVWLRAARAHAAWRGAETIAEQDIDAVAELALRHRRREQSSSPAQPPAQSPSGTH
AEPSEGQGQWGEMPAPALVTGARREVPTWPKKL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccccgcatttcccgctctccgccgtggtcggcgccgatgatttgaaactg
gcgctgtacctgacggccattgacccgaaaatcggcggcgtgctgatcgaaggcccgcgt
ggcatggccaagtcgacgctcgcccgggggctggcggatctgttggccagtggtcagttc
gttaccttgccgttgggtgctactgaagagcgattggtcggcacgctggatctggacgcg
gcgttgagcgacggtcgtgcgcagttttctccgggtgtgctggcgaaggcggacggcggc
gtgttgtacgtcgatgaggtgaatctgttgccggatcatctggtggatctgctgcttgat
gtggctgccagcggcaccaacctgatcgagcgcgacggcatttcccatcgacattcggcg
aagttcgtattgatcggcacgatgaacccggaagagggggaattgcgtccgcaattgctg
gatcgtttcggccttaacgtcgcgctgagcggtcatacggcgccggccgagcgggggcag
atcattcgtcgtcggctggatttcgacagcgacccgcaggtgttttgtgcgcagtgggag
gctgatcagcaagctctgcgtgagcgttgtgaaagcgcccgccatgccttggcgaatatt
cccctcgacgatgaagcgctggcacagatcaccgagcgctgctttgcggcaggcgtcgac
ggtttgcgcgccgatctggtctggctgcgtgcggcgcgggctcatgcggcgtggcgcggg
gctgaaaccattgccgagcaagacattgatgccgtggctgagcttgcattgcgccatcgt
cgccgcgaacagtcttcatcccctgcacagccaccggcgcaatcgccgtccggtactcac
gccgaaccgagcgaagggcaggggcaatggggtgaaatgccggcaccggcattggttacc
ggcgcacgccgtgaagttccgacctggccaaaaaagctttag

DBGET integrated database retrieval system