KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3755Help
Entry
Pfl01_3755        CDS       T00283                                 

Gene name
selD
Definition
(GenBank) selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00450  Selenocompound metabolism
pfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pfl01_3755 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfo03016]
    Pfl01_3755 (selD)
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Pfl01_3755 (selD)
Transfer RNA biogenesis [BR:pfo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Pfl01_3755 (selD)
 Prokaryotic Type
    Pfl01_3755 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABA75493
UniProt: Q3K9R1
Position
complement(4243347..4244381)
Genome map
AA seq 344 aa AA seqDB search
MTEPIRLTQYSHGAGCGCKISPKVLEVILAGSGAQNLDPKLWVGNASRDDAAVYEIDAER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLAPEVARDV
IRGGRAVCDAAGIPLAGGHSIDAPEPIFGLAVTGLVEKRFMKRNDTATAGCLLYLTKPLG
IGILTTAEKKGKLRPDDIGVARDWMCTLNKPGSRFGKLAGVTAMTDVTGFGLLGHLVEMA
DGSHLTARVFYDRVPRLSSIEYYLEQGCVPGGTLRNFDSYSSRVGRVQELHKRVLCDPQT
SGGLLVAVTPEGNAEFLAVAAELGLALEPIGELIGRQSHAVEVN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcccatccgtctgacccaatacagccacggcgccggctgtggctgcaagatt
tcgcccaaggtgctggaggtgattctggccggcagcggggcgcagaatcttgatccgaaa
ctgtgggtcggcaacgcgtcgcgcgatgacgcggcggtgtatgaaatcgatgccgagcgc
ggggtggtctcgaccacggattttttcatgccgatcgttgatgacccgttcgacttcggc
cggattgccgccaccaatgccatcagcgacatctacgccatgggcggcgatccgttgatg
gcgattgcgatcctcggctggccggtcaatgtgctggcgccggaagtggcgcgggacgtg
atacggggggggcgagcggtgtgcgatgcggcggggattccactggccggcgggcattcg
atcgatgcaccggagccgatcttcggtctggctgtcaccgggcttgtggaaaagcgcttc
atgaaacgcaacgacacggccaccgccggttgcctgctgtacctgaccaaaccattgggc
atcggcatcctcaccaccgccgaaaagaagggcaagctgcgccccgacgacatcggcgtg
gcccgggactggatgtgtacgctgaacaagcccggcagccgtttcggcaaactggccggg
gtcaccgccatgaccgacgtcaccggtttcggcctgctcgggcatctggtagaaatggcc
gacggcagtcacctgacggcgcgggttttctatgaccgggtgccgcgtctttcgagcatc
gagtattacctcgaacagggctgcgtgcccggtggcaccttgcgcaatttcgacagctat
tcgagccgcgtcgggcgggtccaggaattgcacaagcgagtgttgtgcgacccgcagacc
agcggcggtctgctggtggccgtgacgcctgaaggcaatgccgaattcctcgccgtcgct
gccgaactcggcctcgcgcttgagccgatcggtgagttgatcgggcgacagagccacgcg
gtcgaggtgaattga

DBGET integrated database retrieval system