KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4276Help
Entry
Pfl01_4276        CDS       T00283                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00260  Glycine, serine and threonine metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
pfo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pfl01_4276 (ltaA)
Enzymes [BR:pfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Pfl01_4276 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP DUF4031 Arylesterase
Motif
Other DBs
NCBI-ProteinID: ABA76013
UniProt: Q3K891
Position
complement(4825654..4826658)
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTPAMLDAMTRADTGDDVYGEDPTVNRLEAELAKRLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVQADGSLDLDQVAA
AIKPDDFHFARTRLLALENTMQGKVLPLDYLARARQFTRDNGLQLHLDGARLYNAAVKLG
VDAREITQYFDSVSVCLSKGLGAPVGSVLCGSSALIAKARRLRKMVGGGMRQAGLLAAAG
LYALDHNVERLADDHANAQLLAEGLREAGFSVEPVQTNMVYVQMGDRAEAIKAFAAERGI
KLSAAARLRMVTHMDVNRSQIEQVIATFVEFSRK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatcgatcttcgcagcgacaccgtcactcaaccgactcccgccatgctcgac
gcgatgacccgcgccgacaccggtgacgacgtgtatggcgaagatccgacggtcaatcgt
ctggaagccgaactggcaaaacggctcggttttgctgccgcgctgttcgtcccgaccggc
accatgagcaacctgctgggcttgatggcgcactgcgagcgcggtgacgagtacatcgtc
ggtcaacaggcacacacctataaatacgaaggcggcggcgcagcggtgctcggctcgatt
cagccacagccgctggaagtgcaggccgacggctcgctggacctggatcaggtggccgcg
gcgatcaagcccgacgatttccacttcgcccgcacccgcctgctggcgctggaaaacacc
atgcagggcaaagtgttgccgctggactatctggcccgggcccgccagttcactcgggac
aacggcctgcaactgcatctggacggcgcgcggctgtacaacgcggcggtcaagctgggg
gtcgatgcccgggaaatcacccaatatttcgattcggtctcggtgtgcctgtccaaaggc
ctcggcgcgccggtcggttcggtgctgtgcggttcgtcggcgttgattgcaaaggcccgg
cgcctgcgcaaaatggtcggtggcggcatgcgtcaggccggactgctggcggcggcgggg
ctgtatgcgctggatcacaacgtggagcgtcttgccgatgaccatgccaacgcacagttg
ctggccgaaggcttgcgcgaggccggtttcagtgtcgagccggtgcagaccaacatggtt
tacgtgcagatgggcgaccgtgccgaggcgatcaaggcatttgccgccgaacgcgggatc
aagttgagcgctgccgcccgtctgcggatggtcacgcacatggacgtcaatcgctcgcaa
atcgagcaagtgatcgcgacattcgtcgagttttcgcgcaagtga

DBGET integrated database retrieval system