KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4319Help
Entry
Pfl01_4319        CDS       T00283                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Pfl01_4319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABA76056
UniProt: Q3K848
Position
4875225..4876838
Genome map
AA seq 537 aa AA seqDB search
MATPSLTASLAPTASGRPALDKKTGPFTYVVFFAVLAMGMLFTAYSLMHDMHELGTVVTT
WTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPNVAVVWSGFFNFLGVLLSS
GAVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSII
GVGVANALMHGRDGTSGVDWAQATKIGYALLLSPLVGFGCAALLLLALRAFVKNRSLYKA
PEGNTPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPEEQ
SLQFAAVAQVTQQALVKSAPLPAPADPRAVLSDYMRSKQATPQLIPALASLTGHIGEEVK
GYGSLAKVPAEAMGNVRNDMYLASETIRLMDKNKVGSFDADTSGKLQLFKQQIDNATRFI
PLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAETVAMLTIGAADMFGL
PVSTTHVLSSGVAGTMVANGGGLQMKTIRNLLMAWVLTLPAAIVLSGSLYWLFTQIF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggctactccctccctgaccgccagcctggcccccactgccagtggcaggccggcgctc
gacaaaaaaaccggcccctttacttacgtggtgttcttcgccgtgctggccatggggatg
ctgttcaccgcctacagtctgatgcatgacatgcacgaactcggcacggtggtcaccacc
tggacgccgttcctgctgctcggcgtggcgctgttgattgcactgggttttgaattcgtc
aacggtttccatgacaccgccaacgccgtggccacggtgatctacacccactcgctgccg
ccgaatgtggccgtggtgtggtcgggtttcttcaacttcctcggggtactgctttcgagc
ggcgcggtggcgttcggcatcattgcgctgttgccggtggagctgattctgcaagtgggt
tcgtccgccggtttcgcgatgatcttcgccctgctgatcgcggcgatcctgtggaacctc
ggcacctggtggctgggcctgccggcctcgtcgtcgcacacgctgatcggttcgatcatc
ggcgtcggcgtggccaacgcgttgatgcatggtcgcgacggcaccagcggtgtggactgg
gcccaggcgaccaagatcggttacgcactgctgctgtcgccgctggtgggtttcggttgt
gcggcgctgttgctgctggcgttgcgcgcgttcgtaaagaaccgctcgctgtacaaggca
ccggaaggcaataccccgccgccgtggtggattcgtggtttgctgatcctgacctgcacc
ggcgtgtcgttcgcacacggttccaacgacggccagaaaggcatgggcctgatcatgctg
attctggtcggcactctgccgatggcttatgcactgaaccgcaccatgccggaagaacag
tcgctgcaatttgccgccgtcgcccaagtgacccagcaagcgctggtaaaaagtgcgcca
ctgccggcaccggccgatccacgcgccgtgctctcggattacatgcgcagcaagcaagcc
acgccgcaactgatccccgccctcgcctcgctgaccggacacatcggtgaagaagtcaaa
ggctacggctcgctggcgaaagtcccggccgaggccatgggtaacgtgcgtaacgacatg
tacctggccagcgaaaccattcgcctgatggacaagaacaaggtcggcagcttcgacgcc
gacaccagcggcaagctgcaactgttcaaacagcagatcgacaacgccacgcggttcatt
ccgctgtgggtgaagatcgccgtggcgattgccttgggtctgggcaccatggtcggctgg
aagcggatcgtggtcacggtcggcgagaagatcggcaagacccacctgacctacgcccag
ggcgcctcggcggaaaccgtggcgatgctgaccatcggcgccgccgacatgttcggcttg
ccggtctcgaccacccatgtgttgtcctcgggcgtggccgggaccatggtcgccaacggt
ggcggcttgcagatgaagaccatccgcaatctgctgatggcgtgggtgctgaccttgccg
gcggcgattgtgctgtcgggcagcctgtattggctgtttacccagatcttctga

DBGET integrated database retrieval system