KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4724Help
Entry
Pfl01_4724        CDS       T00283                                 

Definition
(GenBank) putative malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00020  Citrate cycle (TCA cycle)
pfo00620  Pyruvate metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01200  Carbon metabolism
Module
pfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pfl01_4724
   00620 Pyruvate metabolism
    Pfl01_4724
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Pfl01_4724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABA76461
UniProt: Q3K6Z3
Position
5330691..5332199
Genome map
AA seq 502 aa AA seqDB search
MAHNEAVDVVLVGAGIMSATLAVLLKELDPAIKLEVVELMDSGAAESSNPWNNAGTGHAG
LCELNYTPQAADGTVDIKKAVHINTQFEVSKQFWSYLTKKGTFGSCKSFISPVPHLSYVE
GEKGVSFLKERFNTLRKHHAFADMEYTEDKAKMTEWMPLMMPGRPKDQVLAATRVINGTD
VNFGALTNQLLKHLTSAPDAQVKYCKRVTGLKRNGNGWTVSIKDVNSGSSREVDAKFVFL
GAGGAALPLLQASGIEESKGFGGFPISGQWLRCDNPEVVKHHQAKVYSQAAVGSPPMSVP
HLDTRVVDGKKSLLFGPYAGFTTKFLKHGSFMDLPMSVRAGNIGPMLAVAKNNMDLTKYL
VSEVMQSMEQRLESLRRFYPEAKAEDWRLEVAGQRVQIIKKDPKKGGILQFGTELVAAKD
GSLAALLGASPGASVTVSIMLELIEKCFPAKAKGEWAAKLAEIFPAREKVLETDAALYRK
INTQNNVALELVEASNETESYA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacgaagcagtcgacgtagttctggttggggccggcatcatgagtgccacc
ctcgcagtactgctcaaagagctcgacccggcgatcaagctggaagtcgtcgagttgatg
gattccggtgccgcggagagttccaacccctggaacaacgccggtaccggccacgccggc
ctgtgcgagctgaactacacgccgcaggctgccgacggcaccgtcgacatcaagaaggcc
gtgcacatcaacacccagttcgaggtgtcgaagcagttctggtcgtacctgaccaagaaa
ggcacgttcggctcgtgcaaatcctttatcagcccggtgccgcacctgagttacgtcgag
ggtgagaaaggcgtgtcgttcctcaaggaacgtttcaatacgctgcgcaagcaccacgcc
ttcgccgacatggaatacaccgaagacaaggcgaagatgaccgagtggatgccgctgatg
atgccgggtcgtccgaaagaccaggtgctcgccgccacccgcgtgatcaacggcaccgac
gtcaacttcggcgccctgaccaatcagctgctcaagcacctgaccagcgcacccgatgcc
caggtcaagtactgcaagcgcgtgaccggtctcaagcgtaacggcaacggctggaccgtc
agcatcaaggacgtcaacagcggcagcagccgtgaagtcgacgccaaattcgtgttcctc
ggcgccggtggcgcggccctgccgctgctgcaagcctcgggcatcgaagagagcaaaggc
ttcggcggcttcccgatcagcggccagtggctgcgttgcgacaacccggaagtggtcaag
catcaccaggccaaggtttacagccaggccgccgtgggttcgccaccgatgtccgtgccg
cacctggacacccgcgtggtcgacggcaagaaatccctgctgttcgggccatacgccggt
ttcaccaccaagttcctcaagcacggatccttcatggacctgccgatgtcggttcgcgcc
ggcaacatcgggccgatgctggccgtggcgaaaaacaacatggacctgaccaagtacctg
gtcagcgaagtgatgcagtcgatggaacagcgtctggaatccctgcgccgtttctacccg
gaggcgaaagccgaagactggcgcctggaagtagccggccaacgggtgcagatcatcaag
aaagacccgaaaaaaggcggcatcctgcagttcggtaccgaactggtggcagcgaaggac
ggctccctcgccgccctgctcggcgcttcgccaggcgcttcggtgaccgtctcaatcatg
ctggaactgatcgagaagtgcttcccggccaaggccaagggtgagtgggctgccaaactg
gcggaaatcttcccggcccgcgaaaaggtcctggaaaccgacgctgcgctgtatcgcaag
atcaacacgcagaacaacgtcgcgctggaactggttgaagccagcaacgagaccgaaagc
tacgcctga

DBGET integrated database retrieval system