KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5017Help
Entry
Pfl01_5017        CDS       T00283                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00740  Riboflavin metabolism
pfo00790  Folate biosynthesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
Module
pfo_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Pfl01_5017 (ribB)
   00790 Folate biosynthesis
    Pfl01_5017 (ribB)
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Pfl01_5017 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Pfl01_5017 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 Lip_A_acyltrans
Motif
Other DBs
NCBI-ProteinID: ABA76754
UniProt: Q3K650
Position
complement(5652142..5653233)
Genome map
AA seq 363 aa AA seqDB search
MALNSIEELVEDIRQGKMVILMDDEDRENEGDLIMAAECCKAEHINFMAKYARGLICMPM
SRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAADRARTVQAAAAKDAKAED
IVSPGHIFPLMAQAGGTLARAGHTEAACDLARMAGFEPSGVICEVMNDDGTMSRRAELEA
FAAEHDIKIGTIADLIHYRMIHERTVQRIAEQPLDSELGQFNLVTYRDSVEGDVHMALTL
GTVCAEEPTLVRVHNMDPLRDLLMVKQPGRWSLRAAMAAVAEAGSGVVLLLGHPLDGDVL
LAHIRETGDQAAVKKPTTYSIVGAGSQILRDLGVRKMRLMSAPMKFNAISGFDLEVVEYV
PSE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcaatagcatcgaagaactggttgaagacatccgccaaggcaagatggtcatt
ctcatggatgacgaagaccgcgagaacgaaggcgacctgatcatggccgccgaatgctgc
aaggccgagcacatcaacttcatggccaagtacgcccgtggcctgatctgcatgccgatg
agccgcgagcgttgcgaaaccctgaagttgccgctaatggcgccacgcaacggttccggt
ttcggcaccaagttcaccgtctcgatcgaagccgccgaaggcgtgaccaccggcatctcc
gccgctgaccgcgcacgcaccgtgcaagcggccgctgcgaaagacgccaaggcggaagac
atcgtcagcccgggccacattttcccgctgatggcccaggctggtggcaccctggcccgc
gccggtcacaccgaagccgcctgcgacctggcgcgcatggccggtttcgagccaagcggc
gtgatctgcgaagtgatgaacgacgacggcaccatgtcccgtcgcgccgaactggaagct
ttcgccgccgaacacgacatcaagattggcaccatcgccgacctgattcactaccggatg
atccacgaacgtaccgttcagcggattgccgagcagccgctggacagcgaactgggccaa
ttcaacctggtgacctatcgtgattccgtggaaggcgatgtgcacatggcactgaccctc
ggcaccgtttgcgccgaagaaccgaccctggttcgcgtgcacaacatggatccgctgcgc
gacctgctgatggtcaagcagccgggccgctggagcctgcgcgccgccatggctgcggtc
gccgaggccggcagcggtgtggtgttgctgctcggtcacccgctggatggcgacgtgttg
ctggcgcacatccgcgaaaccggcgatcaggcggcggtgaaaaaaccgaccacctacagc
atcgtcggtgccggttcgcagatcctgcgtgacctcggcgtgcgcaaaatgcgtttgatg
agcgcgccgatgaagttcaatgcgatatccggtttcgatctggaagttgtagaatacgtg
ccctccgaataa

DBGET integrated database retrieval system