KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5574
Entry
Pfl01_5574        CDS       T00283                                 

Definition
(GenBank) putative Rhs element VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pfl01_5574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5574
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pfl01_5574
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ABA77311
UniProt: Q3K4J3
Position
complement(6242365..6244590)
AA seq 741 aa
MFNPANETHFSLTVEDYVGDLQVLSFTGTEGISQPFRFDIELVSENPDLDLEKLLHKQAF
LALDPQGSGIHGQIYRVAQGDAGKRLTRYKVSLVPQLQYLHHRTNQRIYQQMSAPKIIAL
ILDEHGIKGNAYSFQLSQPCPDRDYCVQYDETDLHFVQRLCEEEGIHYHFQHSKKGHLLV
FGDDQTVFPNLGQPTAYVQGSGMVAEEPVIKGFKLRLETRTSRTTRRDYDFEKPRLQMEA
AYKPDGESTEPDLEDYDYPGRFIDRARGKFLSQRALERHRADYRQAEGRGDQTRLVSGHF
MEMSDHPRSEWNDLWLLTEIFHEGKQPQVLEESVTSDTTDNKDDFHQGYRNRFLATPWDV
FYRPALEHPKPRVLGSQTAMVTGPKGEEIHCDQYGRIKVQFHWDREGLADDKTSCWLRVS
SSWAGDRYGAISIPRIGMEVLVTFLEGDPDQPLVTGCLYHKENPVPYALPANKTRSVFKT
LSSPGGGGYNELRIEDKKGAEQIFIHAQRDWDENVEHDQKIRVGNERHDTVVKNSYTELK
AEEHRTTISDRKIEAKADDHLTVGESQHIKLGTAQLTSVGKEIHLKSGDKMVIEAGTELT
ILGGGSFIKLDGGGVTVVGPVVKINAGGSAGSGTGIGILAPVIPLIADQARAGNTLKSGT
ANSPKYDEQIRFVTGLGQPIKSVKAAIIVPSSVAPKISKSNADGLHPRVVTDSEETAEVH
LMWDELIVPEGSDDYEASRNK
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgttcaacccagctaacgaaacgcacttcagcctgaccgttgaagattacgtaggcgac
ctgcaagtcctgtcgttcaccggcaccgaaggcatcagccagccgttccgtttcgacatc
gaactggtcagcgaaaacccggatctggacctggaaaagctcctgcacaaacaggccttc
ctcgccctcgatccgcagggctcgggtatccacggccagatctaccgcgtggcccagggc
gatgccggcaagcgcctgacccgctacaaagtctcgctggtgccgcagctgcaatacctg
catcaccgcaccaaccagcgcatctaccagcagatgtcggcgccgaaaatcatcgcactg
atcctcgacgagcacggcatcaagggcaacgcctacagctttcagttgagccagccgtgc
ccggaccgcgactactgcgtgcagtacgacgaaaccgatctgcacttcgtccagcgcctg
tgcgaagaagaggggattcactaccacttccagcacagcaagaaaggtcatctgctggtg
ttcggcgatgaccagaccgtgttccccaacctcggacaaccgaccgcgtatgtacagggc
agcggcatggtcgccgaagaaccggtgatcaaaggcttcaagctgcgtctggaaacccgc
accagccgcaccacccgccgcgactacgatttcgagaaaccgcgcctgcaaatggaggcg
gcgtacaaaccggacggcgagagcactgaaccggatctcgaagactacgactaccccggc
cgtttcatcgaccgcgcgcgcggcaagttcctcagccagcgcgccctcgaacgccaccgt
gccgactaccgccaggccgaaggtcgcggtgaccagaccagactcgtcagcggccacttc
atggaaatgtccgaccacccgcgcagcgagtggaacgacctgtggctgctcaccgaaatt
ttccacgaaggcaaacagccgcaagtcctcgaagaatcggtgaccagcgacaccaccgac
aacaaggacgacttccaccagggctaccgcaaccgcttcctcgccaccccgtgggacgtg
ttctaccgccccgcgctcgaacacccgaaaccccgcgtgctcggcagccagaccgcgatg
gtcaccggccccaaaggcgaagaaatccactgcgaccaatacggccgcatcaaagtgcaa
ttccactgggaccgcgaaggcctggccgacgacaaaaccagctgctggctgcgcgtctcc
agctcctgggccggcgaccgctacggcgccatctccatcccgcgcatcggcatggaagtc
ctcgtcaccttcctcgaaggcgaccccgatcaaccgctggtcaccggctgcctgtaccac
aaggaaaacccggtgccgtacgccttgccggcaaacaaaacccgcagcgtcttcaaaacc
ctcagctccccgggcggcggtggctacaacgaactgcgcatcgaagacaaaaaaggcgcc
gaacagatattcatccacgcccagcgggactgggatgaaaacgttgagcacgaccagaag
attcgcgtcgggaatgaacgtcacgacacggtggtgaagaacagctacaccgagctcaag
gcagaagaacaccgcaccaccataagcgaccgcaagatcgaagcgaaagccgacgatcac
ctgacggtaggagaaagccagcacatcaagctcggtaccgcccagttgaccagtgtgggg
aaagagatccacctgaagtctggcgacaagatggtgattgaggctggcaccgaactgacc
attctgggcggtgggagctttatcaagctcgatggcggtggtgtgacggtggttggaccg
gtggtgaagatcaatgccggaggctcggcgggaagcggtacggggattggcattctggca
ccggtcattccgctgattgcggatcaggctagggcggggaacacactgaagtctggtact
gccaatagtccgaagtatgacgaacaaatccgttttgtgaccgggctcggtcaacccata
aagtctgtgaaggcagcgattattgtcccttcgtcggtcgctcctaaaatctccaaaagc
aacgcagatggtctgcatccgcgtgtggtgactgacagcgaggaaaccgctgaggtccat
ctgatgtgggacgaactcatcgtgccggaaggctccgacgattacgaagcgagtagaaat
aaatga

DBGET integrated database retrieval system