KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5575
Entry
Pfl01_5575        CDS       T00283                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K11916  serine/threonine-protein kinase Stk1 [EC:2.7.11.-]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5575
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     Pfl01_5575
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pfl01_5575
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1
Other DBs
NCBI-ProteinID: ABA77312
UniProt: Q3K4J2
Position
complement(6244619..6245620)
AA seq 333 aa
MTEIESSVDDLLMSEEQANNLTYFAFAKQHNAEPALAPTKASVGALPDVLAGRYHLERLL
GAGGMGAVYRARDLLHEQFGDPDPYIALKILSEEFAESPDASALLYSEFALTRRLRHDNV
LRPHTFEVDTDCQRAFITMELMRGLTLDKLLCERPLGLPWKELRDIALPLLDALAYAHRR
GVLHGDMKPSNVMLSEDGVRLFDFGLGQAEEGILPGLPHLSRERFNAWTPGYAAPELLEG
QPLSASADVYGVACVIYELAGGKHPFRRLPSTQARDEHLERELQAPANLPTHCWPALRTA
LAFDAAERNISAEQLRDALGATSSWLQRLRLRA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgactgaaatcgaatcctcagtcgacgacttgctgatgagcgaagagcaggccaacaac
ctgacttatttcgccttcgccaagcaacataatgccgaacccgcgctggcgccgaccaag
gccagcgtcggcgcactgccggatgttctggcaggccgctaccacctcgagcgtctgctc
ggggccggtggcatgggagcggtttaccgggcccgggatctgctgcacgagcagttcggc
gatcccgatccttacattgcgctgaaaatcctcagcgaagaatttgccgagtcgccggac
gccagtgccttgctctacagcgagtttgccctgacccgacgcctgcgccacgacaacgtg
ctgcgaccgcacacgttcgaagtcgacaccgattgccagcgggccttcatcaccatggaa
ctcatgcgtggcctgactctggacaaactgctctgcgagcggccgctgggcctgccgtgg
aaagaactgcgcgacatcgcgctgccgctgctcgacgcgctggcctacgcccaccgtcgc
ggcgtgctgcacggtgacatgaagccgagcaacgtcatgctcagcgaagacggcgtgcgc
ctgttcgacttcggtctcgggcaagccgaggagggcatcctgcccggcctgccgcacctg
agccgcgagcgcttcaacgcctggacaccgggctacgccgcccccgaactgcttgagggc
caaccgctgtcggccagcgcggacgtgtacggcgtggcctgcgtgatctatgaactggcg
ggcggcaaacacccgttccgccgcttgccctcgacccaggcccgtgacgaacacctggag
cgcgagctgcaagccccggcaaatctaccgacacactgctggcccgcgctgcgcaccgcg
ctggcctttgacgcggcagagcgcaacatttctgccgaacaattgcgtgacgccttgggc
gccacttcgtcctggctgcagcgtttgcgactgcgggcgtaa

DBGET integrated database retrieval system