KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5576
Entry
Pfl01_5576        CDS       T00283                                 

Definition
(GenBank) putative protein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo02025  Biofilm formation - Pseudomonas aeruginosa
pfo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pfl01_5576
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pfl01_5576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5576
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Pfl01_5576
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pfl01_5576
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-ProteinID: ABA77313
UniProt: Q3K4J1
Position
complement(6245617..6246345)
AA seq 242 aa
MLVASPWRSAARTDPGKVRSRNEDAFLDTPQHGLWVVADGMGGHQGGDIASQLIVASLAE
LPQHEDFDERLKAIRQCLHWLNRRLGQELTVTAGRHDSIMGSTVVALLVDGNRAACIWAG
DSRCYMWRGQRLYQLSKDHSLQQQLIDEQQMSVEQAAAHPAAQALTRAVGAAEQLTLDVL
ELEVYPGDVFLLCSDGLYQGLSSDALGNALSLAAPHVALERLFDGALRGAARDNLTAVVI
RQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgctggtggccagtccctggcgcagcgcggcgcgaaccgacccgggcaaggtgcggtcg
cgcaacgaagatgccttcctcgacaccccgcagcatgggctgtgggtggtcgcggacggc
atgggcggtcatcagggtggcgacatcgccagccagttgatcgtcgccagcctggctgaa
ctgccgcagcacgaagatttcgacgaacgcctcaaagccatccgccagtgcctgcactgg
ctgaaccggcgcctggggcaggagttgaccgtcaccgccgggcgccacgacagcatcatg
ggcagcaccgtcgtggcgctgctggtggacggcaatcgcgcggcctgcatctgggccggc
gacagccgttgctacatgtggcgcgggcagcggttatatcagctgtcgaaggatcactcg
ctgcagcaacaactgatcgacgaacagcagatgagcgtcgaacaggcagcggcgcacccg
gcggcccaggccctgacccgggcggtcggcgcggcggaacagttgaccctggatgtgctg
gaactcgaggtctatcccggtgatgtgttcttgctgtgcagcgatggtttgtatcaaggc
ctgagcagcgatgccctcggcaatgctctcagcctggcggcgccacacgtggcgctggaa
cgtctgttcgacggcgccctgcggggtgccgctcgcgacaacctgacggccgtggtgatc
cgccaatga

DBGET integrated database retrieval system