KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5581
Entry
Pfl01_5581        CDS       T00283                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5581
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pfl01_5581
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABA77318
UniProt: Q3K4I6
Position
complement(6252619..6253812)
AA seq 397 aa
MELVFEMLNTKQFVPTELCQRTFKQAGGVIGRGEDCDWIIPDRKRHLSNHHAIVSYREGT
FFLTDTSSNGVQDGDSGARLHKGEPVRIEHGSTYVLGDFEIRARLVRDPATFDGEVGLPR
AAGSIIPDDAFLDLDPLKSLEQQERVYSEFEEMLAPVTDPEDSRQRADYARIDMESLMVP
ELIVEPKPEPAPAPKAVERQSETFWDKFGAALGVNVKNLSHDEREALALNAARLLRQSIG
GLQQSLRTRSELKNELRLAQTTVQGTNKNPLKFAVDPSEALDILLQPNKPGHLPAEQAIS
RAFRDLQAHQVALLTASRAAVRGTLEHFSPEQLTLRFERDNKPLLATAGGRWRAFNRYHH
ALRQDDDWSERLLARDFAQAYEEQIRLISTLHTDHQG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggaattggttttcgaaatgctgaacaccaagcagttcgtgcccaccgagctgtgccag
cggaccttcaaacaggccggtggcgtgatcgggcggggcgaggactgcgattggatcatc
cctgaccgcaagcgtcacttgtccaaccaccacgcgatcgttagctatcgcgagggtacg
tttttcctgaccgacaccagcagcaacggtgttcaggacggcgacagcggcgcacgcctg
cacaagggcgaaccggtgcgcatcgagcacggcagcacctacgtgctgggcgacttcgag
attcgcgcgcgcctggtgcgcgacccggcgaccttcgacggtgaagtcggcctgccacgc
gccgccggcagcatcattccggacgatgcgtttctcgacctcgatccgctgaagtcgctg
gagcagcaagagcgcgtgtactcggagttcgaggaaatgctcgcaccggtgaccgaccct
gaagactcccgtcagcgcgccgactatgcgcgtatcgacatggaaagcctgatggtgccg
gagctgatcgtcgagcccaagcctgagcctgcaccggcaccgaaagcagtcgagcgccag
agcgaaaccttctgggacaaattcggcgcggccctcggcgtgaacgtgaagaacctcagc
cacgacgagcgtgaagctcttgcgctgaacgctgctcgtctgctgcgccagagtatcggc
ggtctgcaacagagcctgcgcacccgttccgagctgaagaacgagctgcgtctggcccag
accaccgtgcaaggcaccaacaagaatccgctgaaattcgccgtcgacccgagcgaagcg
ctggacatcctgttgcagccgaacaaaccgggccacttgccggccgagcaggcgatttcc
cgcgcgttccgcgatttgcaggcgcatcaggtggcgctgctgaccgccagccgcgcggcg
gtacgcggcactctggagcacttctcgccggagcagttgaccctgcgtttcgagcgcgac
aacaagccgttgctcgccaccgctggcgggcgctggagagcgttcaaccgttaccaccac
gcgctgcgtcaggacgacgactggagcgagcgcctgctggcccgcgacttcgcccaggcc
tacgaagaacagatccgcctgatctccaccctccacaccgaccaccaaggatga

DBGET integrated database retrieval system