KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5583
Entry
Pfl01_5583        CDS       T00283                                 

Definition
(GenBank) sigma-54 dependent DNA-binding response regulator
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pfo03000]
    Pfl01_5583
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5583
Transcription factors [BR:pfo03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    Pfl01_5583
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pfl01_5583
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 HTH_30 GAF HTH_50 GAF_3 AAA_16 GAF_2 HTH_28 AAA_7
Other DBs
NCBI-ProteinID: ABA77320
UniProt: Q3K4I4
Position
complement(6254065..6255591)
AA seq 508 aa
MFTQVPQPLLYAEALLAQFASLSRAADGAALLGDFVRGLAGLSGCELTQLYLLDATHTSL
GMNAECLDGVLQPRSAASLPADYNGEQLLQFALCQNRVVSFDDLGGSLHETSFLPASSTP
WQSLLCVPLVNQQKAVEGLLLCASRRHIDLQGFADSLGQLGSFVLGQLHLLQRLRQPVDA
AAPVVRSLPSASGYGLIGKSAAMRQTYSLISKVLHSPYTVLLRGETGTGKEVVARAIHDC
GPRRSQAFIVQNCAAFPENLLESELFGYRKGAFTGADRDRAGLFDAANGGTLLLDEIGDM
PLSLQAKLLRVLQEGEIRPLGSNDTHKIDVRIIAATHRDLSVLVSEGKFREDLYYRLAQF
PIELPALRQREGDILDLAKHFADKACTFLQRDPVRWSDAALEHLSGYTFPGNVRELKGLV
ERAVLLCEGGELLAEHFSLRLESAPAPEDHCGLNLRERLEAVERNLLLDCLRKNDGNQTL
AARELGLPRRTLLYRLGRLNINLGDFDG
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttcactcaagtgccgcagccactgctctatgccgaagccttgctggcgcagttcgcc
agcctgtcgcgcgcggcggacggtgctgcgctgctgggtgacttcgtgcgcggtctggcc
gggctgagcggttgcgaactgacgcagctgtacttgctggacgccacgcacacgtcgctg
ggaatgaacgccgaatgcctcgacggtgtgctgcaaccgcgcagcgcggcgagcctgccg
gcggactacaacggcgagcaactgttgcagttcgccctgtgccagaaccgcgtggtgagc
ttcgacgacctgggcggcagcctgcacgaaaccagttttctgccggcgtcgtccacgccg
tggcagtcgctgttgtgcgtgccgctggtcaatcagcagaaggccgtcgaaggccttctg
ctgtgcgcaagccgtcgccacatcgacctgcaaggcttcgccgattccctcggccagctc
ggctcgttcgtgcttggtcagctgcatctgctgcagcgtctgcgccagccagtggatgcg
gccgcgccggtcgtgcgcagcctgccgagtgccagtggctatggcctgatcggcaagagc
gcggcgatgcgccagacctactcgctgatcagcaaagtcctgcacagcccgtacaccgtg
ctgttgcgtggcgagaccggcaccggcaaggaagtggtcgcgcgggcgatccacgattgc
ggcccgcgccggtcccaggcgttcatcgtgcagaactgcgcggcgttcccggaaaacctg
ctggaaagcgagctgttcggctaccgcaaaggtgcgttcaccggcgccgatcgcgaccgc
gccgggctgttcgacgcggccaacggcggcactctgttgctcgatgaaatcggcgacatg
ccgctgtcgctgcaagccaaattgctgcgtgtattgcaggaaggcgagatccgtccgctg
ggttccaacgacacccacaagatcgacgtgcgaattatcgctgcgacgcaccgcgatctg
tcggtgctggtcagcgaaggcaaattccgtgaggacctgtactaccgcctcgcgcaattt
ccgatcgagttgccggccctgcgtcagcgtgaaggcgacatcctcgacctcgccaaacac
ttcgccgacaaggcctgcactttcctgcaacgtgatccggtgcgctggtcggacgcagcg
ctggaacacctgtccggttacaccttccccggcaacgtgcgtgaactcaaaggtctggtc
gaacgcgcggtgctgttgtgcgagggcggcgagttgctggccgaacatttctcgctgcgc
ctggaatcggcgccagcgccggaagaccactgcggcctcaatctgcgcgaacgactggaa
gcggtcgaacgcaatctgttgctcgattgcctgcgcaagaacgacggcaaccagacgctc
gccgcccgggaactgggcttgccgcgccgcacgctgctgtaccggctcggccgcttgaac
atcaatctgggtgatttcgatgggtag

DBGET integrated database retrieval system