KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5592
Entry
Pfl01_5592        CDS       T00283                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
SSDB
Motif
Pfam: PAAR_motif FlgD_ig
Other DBs
NCBI-ProteinID: ABA77329
UniProt: Q3K4H5
Position
complement(6263127..6264536)
AA seq 469 aa
MSGKPAARVSDPTACPLPGHGTNPIAAGSGDVFFDGLPAARQGDASACGSALVGDLATTV
LINGKPAATVGSVGAHGNKVTAGSGTVIIGNSHTPAPFSGLAALAVAAALEYRLGLKSGG
NSVLTPLEIPDFDELKSGTSKNRELVDFVVENRMDAADSVKLEVLDGEKPVYTEANTAPF
LPPGKHPWQWDGYDTAGILDTKILKSPNLKVRLTATGAGKQQVTEVKLTCSAEEVKWVDA
RIDRNAKTVEVTLRPSFSEGGSTGSTPGLVPTPLSTLLGWAKEGIELYWSRNGSRGGGIA
EGIATSKGVYKVTVKAEVNVEPKAGNFPLIDSLSADFGRSTSLAIARKVYHNAGYAFDQL
VKRQGLTAADAANYAQEEFKETSAHEFGHLILNEYGGGLIPNYSWTHKETSTLMQNPKAN
HPTPSTGEVDVMHYFSSYTQTSTNLQKRMAASEQDVKSLLWLARVEFND
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtctggcaaaccagcagcacgcgtatccgaccccaccgcttgcccgctccccggccac
ggcaccaacccgatcgccgccggttccggcgacgtgttcttcgacggcctgccagcggcc
cgccagggcgatgcctcggcgtgtggcagtgcattggtcggcgaccttgcgaccacggtt
ctgatcaatggcaagccggccgccaccgtaggttcagtcggggcccatggcaacaaggtc
actgccggctccgggacggtaatcatcgggaattcgcatacgcctgcaccgttttcgggg
cttgctgccctggcggtcgccgctgctctggaataccgactgggtctgaagtcgggtggc
aactcggttttgaccccgctggaaataccggacttcgatgaactgaagtccggaacatcg
aaaaaccgcgaactggtcgacttcgtcgtcgagaaccggatggacgcggcagacagtgtg
aagctggaagtgctggacggcgaaaagccggtctacaccgaagccaataccgccccgttc
ttgccccctggcaagcacccgtggcaatgggatgggtacgacactgccggcatcctcgac
accaaaatcctgaaaagcccgaacctcaaagttcgtctgaccgcgaccggagcgggcaag
cagcaagtcaccgaagtgaagctcacttgttcggctgaagaggtgaagtgggtcgatgcg
cgtattgatcgcaatgccaagaccgtggaagtgacgctgcgcccgagcttctcggagggt
ggcagcactggttccacgcctggcctggtgcctacgccgctcagcactttgctgggttgg
gccaaggagggcatcgaattgtattggtcacgcaatggttcgcgcggtggtggcattgcc
gaaggaatcgcgaccagcaaaggggtctacaaagtcacggtcaaggccgaggtcaacgtc
gagccaaaggccgggaacttcccgttgattgactcgttgtcagcggacttcggtcgttcg
accagcctggcaattgcccgtaaggtttaccacaacgctggctacgcctttgaccaactc
gtcaagcgtcaaggccttacggctgcggatgctgccaactatgcgcaggaagagttcaaa
gagacctcggcccatgaattcgggcatctgattctcaacgaatacggtggtgggctgatc
ccgaactactcgtggacgcacaaagaaacctcaacgttgatgcaaaaccccaaggcaaac
cacccgacaccgagcacgggtgaggtggatgtcatgcattacttcagcagctacacccag
acgtccaccaacctgcagaagcgcatggccgcttctgaacaggacgtgaaaagcctgctt
tggttggccagggttgaattcaatgactag

DBGET integrated database retrieval system