KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5593
Entry
Pfl01_5593        CDS       T00283                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5593
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pfl01_5593
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABA77330
UniProt: Q3K4H4
Position
complement(6264548..6264955)
AA seq 135 aa
MDGYGSLFERLNGDAELRKGRSLEASAMASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDM
RLSLHDSLSQARLAIESFIEAYEPRLSNVRVISLPRDHDQLRLAFSIEGLLEVEGFKRQV
SFAARLDGSGQVKVN
NT seq 408 nt   +upstreamnt  +downstreamnt
atggacggatacggcagcctcttcgaacgcctcaacggcgacgcggaactacgcaagggc
aggagcctcgaggcttcggccatggcgtcggtggctgcccatctggccaaaatgctcagc
acccgggccggcagcgtgcaaacgctgtccgactacgggttgcccgatctcaatgacatg
cgcctgagcctgcacgactccctgagtcaggcccgcctggccatcgaaagcttcatcgaa
gcctacgaaccgcgcctgagcaacgtgcgtgtcatttccctgccgcgtgaccacgaccag
cttcgcctggccttcagcatcgaaggcctgctggaagtcgagggtttcaagcgtcaggtc
agtttcgctgcgcgcctggatggcagcggtcaagtgaaggtcaactaa

DBGET integrated database retrieval system