KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5597
Entry
Pfl01_5597        CDS       T00283                                 

Definition
(GenBank) putative Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pfl01_5597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfo02044]
    Pfl01_5597
Secretion system [BR:pfo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pfl01_5597
SSDB
Motif
Pfam: Phage_GPD DUF2235 Phage_base_V Cupin_3
Other DBs
NCBI-ProteinID: ABA77334
UniProt: Q3K4H0
Position
6269283..6272639
AA seq 1118 aa
MPGAVSSAHFTLQISAVRNDFKVLAFEGTETVSTLYAIHVELVSEDPDFDMEGLLGQTAF
LQFGLNDEGIHGCIDDVLAGESDKRLTRYRLTLVPSLHYLQFSHDQRIYQSQTVPQIITQ
TLKRHGILVDAFTFHVQPLVAREYCTQYGESDFEFIQRLCAEEGIAWHHQHSAQGHLLVF
TDDAVFLPTLRPTPFRRENGMVPEYPVVSSFSLRAATRTSRVTRRGYDLKRPTLLLESRF
SAGFTPTLEDYRYPLLLDNEKRGKHLARQALERHRADYEIAEGQSNQTTLRCGHLLELTE
HPRQNYNGLWLLLGVTHTGRQPQVLEESASSETQSADGFTQGYRNTFCAIPAEVVFRPPL
PARRPPLVSQTARVTGPKGEEIYCDEFGRVKVEFHWDRAELNSERSSCWVRVSSSWAGNG
FGVVTLPRIGMEVVVTFVEGDPDKPLITGCVINKVTPAPYKLPEHKTRTVLRSRSSPDTG
GYSELMIEDRAGLELVYLRAQRDMERQVLHDSRLAVGRDRWESIQGSSQTTAGKIITVEA
GQQVQIKAGASVVLDAGASITLKAGGHHIVIDRGGIFSSTEIVAGGKTSASGAADHPEAA
MAGALAAGLTASSTQDPEDAELEEEEEEVELEDELPAGITLRIGVFFDGTGNNKANSETV
AACYAPDANLAEAAEEIQKHCAAYGYDGNGNSPDNSYGNDVSNIVRLHELYTDHAFDVLP
ENTKQASLRVYIEGIGTTADVDDSLYAQATGRGETGVLARVEQSPEKIMEQIRSLIDSNP
NTLIERIEFDIFGFSRGAAAARHFANEVLKGKRSILAKALPAGSPFLVSSFDWVSQSSIS
INFIGLFDTVAAIANPWLLDFTGANSRNPGLNLKLPEGCANKVVHLVARDEHRENFALNS
LGEIDLVLPGAHSDLGGGYLPRAREKLLLSSPITSTISQSKEATRSAAYVSAEKEAFAWY
TKGVIEDDAPGNQLRVALWEAPVIQRLERGRSTPEPQKRVYAAAMIERPVHGELSLVYLR
IMRELAVRAGVPLKLIPDRSALNLPAELVPIHKKLQAYALGESSVEGLTIKERALLRSRY
IHLSAHWNAAKDFNNSDWSVVFINRPTKNKQRVVHPHE
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgcctggagctgtcagttctgcgcacttcactctgcagatttctgctgttcgcaatgac
ttcaaggtgctggccttcgagggcaccgagaccgtcagcaccctttatgccattcacgtc
gaactggtcagtgaagatcccgacttcgatatggaaggcctgctcggtcagactgccttc
ctgcagttcggcctgaacgatgaaggcattcatggatgcatcgacgatgtgttggcgggt
gaatccgacaaacgcctgacccgctatcgcctgacactggtgccgagcctccactatttg
cagttcagtcacgatcaacggatttaccagagtcagaccgtcccgcagatcatcacgcaa
acgctcaagcgacacggcatcctcgtcgatgcgttcacttttcatgtccagcccctcgtg
gcacgggagtactgcacccaatacggcgaaagcgatttcgagttcatccagcgcctgtgt
gccgaggagggaatcgcctggcatcatcagcactcggcgcaaggccatttgctggtgttc
accgatgatgcggttttcctcccgacattgcgtcccacgcccttccggcgggaaaacggg
atggtcccggaatatccggtggtcagcagcttttccttgcgcgccgccactcggacaagc
cgggtcacccggcgtggttacgacctgaagcgaccgacgcttttactcgaaagccgcttc
agcgccggattcacaccgacgcttgaggactaccgatacccgctgctgctggacaacgaa
aagcgcggcaagcatctggcccgtcaggccctggaacgccatcgcgccgattatgaaata
gccgagggtcaaagcaaccagacgaccctgcgctgtggccatctgcttgaactgaccgaa
caccctcgtcagaactacaacggtctgtggctgctgctcggtgtcacccacaccggacgg
cagccgcaagttctggaggagtcggccagcagcgaaactcaatcggcggacggctttacc
caaggctatcgcaacaccttctgcgccattcctgccgaagtagtgttccgcccgccactg
cccgcacgccggcccccgctggtcagccagaccgccagggtgacaggccccaaaggcgaa
gagatctactgcgatgagttcggtcgggtaaaagtcgaattccactgggaccgagccgaa
ttaaacagtgagcgcagcagttgctgggtgcgggtctcgtcgagctgggccgggaacggt
ttcggtgtcgtcaccctcccccgcatcgggatggaagtggtggtgaccttcgtggaaggt
gatcccgacaagccgctgattaccggctgcgtgatcaacaaggtcacccctgcaccctac
aaacttcccgagcacaagacccgaaccgtgttgcgcagtcgcagctcgcctgacaccggc
ggctacagcgaattgatgattgaagaccgcgccggactggaactggtctacctgcgtgcc
cagcgcgacatggagcggcaggttctccatgacagccggctggcggtcgggcgcgatcga
tgggaaagcattcagggcagcagccagacgacggccgggaaaatcattaccgtcgaggcg
ggccagcaggtgcagatcaaggccggtgccagcgtggtgctggatgcaggcgccagcatc
acgctgaaggcgggcggtcaccatatcgtgatcgacaggggcgggatcttcagcagtacc
gagatcgtggcgggaggaaagacgtccgccagcggagccgctgatcatccagaagccgca
atggcgggagccttggcggccggactgacggcctcatccactcaagacccggaagacgcc
gaactcgaagaagaggaggaagaggtcgaactggaagacgagttacctgctggcatcacc
ttgcggatcggcgtgtttttcgatgggacggggaacaacaaggccaacagcgaaacggtc
gcggcttgctatgcgccagatgccaatctggcggaggcagccgaagagattcagaagcac
tgcgccgcttatggctatgacggaaatggcaactcgccggataacagctacggcaatgat
gtaagcaatatcgtgcggttgcatgagctgtatacagaccatgcctttgacgtattacca
gagaacacgaaacaggcttctttgcgcgtatacatcgaaggcatcggtacaaccgctgac
gtagacgactcactttacgcacaggcaaccggccgaggcgaaacgggtgttctggctcgt
gtggagcagagccctgaaaaaatcatggagcaaattcggtcactgattgatagcaacccc
aacacgctaatagaaagaatcgaattcgatattttcggtttcagtcgaggcgccgccgct
gcacggcacttcgcaaacgaggtgctaaaaggcaagcgcagcattctcgcaaaggcgttg
ccagcaggctctccgttcttggtcagtagctttgactgggtttcacaatccagtatcagc
atcaatttcattggtctgtttgataccgtcgcggcaatcgccaatccatggttgctcgac
ttcactggcgccaacagcagaaatccgggactgaacttgaagctgccggagggttgcgcc
aacaaagtggtgcacctggtggcgcgtgatgaacatcgcgagaactttgcccttaatagc
ctgggtgagattgatctggtattacccggcgcccactcggatctgggaggtggctatctg
cccagggccagggagaaacttctgttgagcagtccgatcaccagcaccatcagccaaagc
aaggaagcgacccgtagcgcagcctatgtctctgccgaaaaggaggcgtttgcctggtat
acgaaaggcgtcatcgaagatgacgctccaggcaatcaactgcgggttgcactctgggaa
gcccctgtcattcaacgattggaaaggggcagatccacaccggagccccagaagcgggtt
tatgctgcggccatgattgaacgcccggtacacggtgagttgtcgctggtgtatttacgc
atcatgcgtgagctggcggtaagagccggggtgccgctcaagctgattcccgacaggtca
gcgctaaatttgcccgcagagttagtacccattcacaaaaaacttcaggcttacgccttg
ggtgagtcatctgttgaagggctgactatcaaagaacgggctttgttacgcagtcgctat
atccacctatctgcgcactggaacgcagccaaagatttcaacaacagcgactggagcgtt
gtttttatcaaccgcccaacaaagaacaaacaacgagtggtgcacccccatgaataa

DBGET integrated database retrieval system