KEGG   Anthracocystis flocculosa: PFL1_01226
Entry
PFL1_01226        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00100  Steroid biosynthesis
pfp01100  Metabolic pathways
pfp01110  Biosynthesis of secondary metabolites
Module
pfp_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PFL1_01226
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PFL1_01226
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 19315352
NCBI-ProteinID: XP_007876920
Position
Unknown
AA seq 502 aa
MVTTRAQSRTPSRSTRARTTSTQHSDGGYTSTESAPGSPTPAPRRPTSNLSKRSSLGVSS
SSSSPLRSKMSKPPTKEQLAPRTAHYEFGGPLGALFVSTTVPLFTYYFYFACSPALGCAP
TLPLTHPEALWQVAKQGLVDSFLDGTAWAIYFGWYAFTVLAWAVLPGRWEEGSELRIGGR
LDYKINAFATLVASFAIAAGIIAVQGPQGFTMLYDHWPGLISASVVNSLVQAFYVYAVSF
QEGKLLALGGNSGNALFDWFIGRELNPRIGRFDIKTFNELRPGLILWALLDLSCACHQYV
KLGGRITDSMALVCAFHTWYVVDALYNESAIFTQMDITTDGFGFMLSVGDLTWVPFIYSL
QARYLAFHPVHLGLLGTLAILLVNFTGYYIFRTANSEKNDFRSGQNPKQLSYMTTASGRK
LLTSGWWGRSRHPNYLGDWIMAWAWSLPCGFATPIPYFYVLFFAILLVHRQIRDDEACRK
KYGKDWDKYCRLVRSRIIPGIY
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggttaccacccgcgcccagtcgcgcacgccctcgcgcagcacccgcgcccgcaccacc
tcgactcagcactcggacggcggatacacgtcgaccgaatccgcacccggcagccccacg
ccagcgcccaggcggccaacctcgaacctctcgaagcgctcctcgctcggcgtctcttcc
tcgtcctcgtcgcccctccgctccaagatgtccaaaccgccgacaaaggagcagctcgcc
ccgcgcaccgcccactacgagtttggcggcccgctcggcgccctctttgtctccaccacc
gtccccctcttcacctactacttctactttgcctgctcgcccgccctcgggtgcgccccc
accctgcccttgacccatccagaggccctctggcaggtcgcaaagcaagggctcgtcgac
agcttcctcgacggcaccgcctgggccatctactttggctggtacgccttcacggtgctc
gcgtgggccgtgctcccgggccgctgggaggagggcagcgagctccgcatcggcggacgc
ctcgattacaagatcaatgcgtttgccacgctcgtcgcctcgtttgccattgccgccggc
atcatcgccgtccagggcccccagggcttcaccatgctctacgatcactggcccggcctg
atctcggccagcgtcgtcaactcgctcgtccaggccttttacgtctacgccgtctcgttc
caggagggcaagctgctcgccctcggcggcaacagcggcaacgcactctttgactggttc
atcggccgcgagctcaacccgcgcatcggccgctttgacatcaagacgttcaacgagctg
cgtcccggcctcatcctctgggcgctcctcgacctcagctgcgcctgccaccagtacgtc
aagctcggcggcaggatcaccgacagcatggccctcgtgtgcgcgttccacacgtggtac
gtcgtcgacgcgctgtacaatgagtctgccatcttcacccagatggacatcaccaccgac
ggcttcggcttcatgctctcggtcggcgatctgacctgggtgccgttcatctacagcctg
caggcgcgctacctcgccttccacccggtccacctcggcctgctcggcacgctggccatc
ctgctggtcaactttaccggctactacatcttccgcaccgccaactcggagaagaacgac
ttccgctccggccagaaccccaagcagctctcgtacatgacgacggccagcgggcgcaag
ctgctcaccagcggctggtggggccgcagccgacaccccaactacctcggcgactggatc
atggcgtgggcgtggtcgctcccctgcggcttcgccacgcccatcccctacttttacgtc
ctcttctttgccatcctcctcgtccaccgccagattcgcgacgacgaggcgtgccgcaaa
aagtacggcaaggactgggacaagtactgccgcctcgtgcgatcccgcatcatccccggc
atctactga

DBGET integrated database retrieval system